Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate 6939374 Sama_3467 cell division ABC transporter, ATP-binding protein FtsE (RefSeq)
Query= uniprot:Q88GX0 (260 letters) >FitnessBrowser__SB2B:6939374 Length = 229 Score = 140 bits (353), Expect = 2e-38 Identities = 80/217 (36%), Positives = 124/217 (57%), Gaps = 3/217 (1%) Query: 20 LIRIEGLNKHY-GAFHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCINRLEVAQQGSIQ 78 +IR E ++K Y G L D++ +R GE L G SG+GKSTL++ I +E A G + Sbjct: 1 MIRFEQVSKVYPGGQKALSDVNFHLRRGEMAFLTGHSGAGKSTLLKLITVIERASAGKVF 60 Query: 79 VDGIDLAATTRE-AAQVRSDIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLSRKDAEERAR 137 ++G D+A +R +R +IGM+FQ+ +L SV DN L P + G S + ++R Sbjct: 61 INGHDIADISRHHVPYLRREIGMIFQNHHLLMDRSVFDNVAL-PLVIEGFSHGEIKKRVA 119 Query: 138 MYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDPEMVAEVLDV 197 L VG+ + P LSGG+QQRV IARA+ KP ++L DEPT LDP++ ++L + Sbjct: 120 AALDMVGLYGKERHNPIMLSGGEQQRVGIARAIVNKPALLLADEPTGNLDPKLSMDILRL 179 Query: 198 LVQLAGTGMTMLCVTHEMGFARQVAERVLFLEGGQII 234 G ++L TH++G ++ R L L G+++ Sbjct: 180 FETFNDAGTSVLIATHDLGLIARMKYRTLTLRQGRML 216 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 154 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 229 Length adjustment: 24 Effective length of query: 236 Effective length of database: 205 Effective search space: 48380 Effective search space used: 48380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory