Align 2-aminoadipate transaminase (EC 2.6.1.39) (characterized)
to candidate 6937472 Sama_1628 bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein (RefSeq)
Query= reanno::Putida:PP_4108 (416 letters) >FitnessBrowser__SB2B:6937472 Length = 405 Score = 207 bits (526), Expect = 6e-58 Identities = 142/414 (34%), Positives = 208/414 (50%), Gaps = 48/414 (11%) Query: 15 PITLSHGRNAEVWDTDGKRYIDFVGGIGVLNLGHCNPAVVEAIQAQATRLTHYAFNAAPH 74 PI G + +WD G+ +IDF GGI V LGHC+PA+V A+ QA +L H + N + Sbjct: 20 PIIPVKGLGSRLWDQQGREFIDFAGGIAVNCLGHCHPALVSALTEQAQKLWHLS-NTMTN 78 Query: 75 GPYLALMEQLSQFVPVSYPLAGMLTNSGAEAAENALKVARGAT------GKRAIIAFDGG 128 P L L + L V ++ NSGAEA E ALK+ R K IIAF G Sbjct: 79 EPALMLAKHL---VDNTFAEKVYFANSGAEANEAALKLVRRVALNKFGADKSQIIAFKQG 135 Query: 129 FHGRTLATLNLNGKVAPYKQRVGELPGPVYHLPYPSADTGVTCEQALKAMDRLFSVELAV 188 FHGRTL T+++ G+ A Y G P + H Y + D+ LKA L Sbjct: 136 FHGRTLFTVSVGGQPA-YSDGFGPKPADIDHAEYNNLDS-------LKA--------LIS 179 Query: 189 EDVAAFIFEPVQGEGGFLALDPAFAQALRRFCDERGILIIIDEIQSGFGRTGQRFAFPRL 248 + A + EP+QGEGG + P F + +R CD+ L++ DE+Q+G GRTG+ +A+ L Sbjct: 180 DRTCAVVLEPLQGEGGIINPTPEFIKGVRELCDQHNALLVFDEVQTGVGRTGELYAYMGL 239 Query: 249 GIEPDLLLLAKSIAGGMPLGAVVGRKELMAALPKGGLGGTYSGNPISCAAALASLAQMTD 308 G+ PD+L AK++ GG P+GA++ EL L G G TY GNP++CA LA+ + Sbjct: 240 GVTPDVLTTAKALGGGFPIGAMLTTTELAKHLVVGTHGSTYGGNPLACAVGLAAFTTVNT 299 Query: 309 ENLATWGERQEQ-------AIVSRYERWKASGLSPYIGRLTGVGAMRGIEFANADGSPAP 361 + + +EQ AI +Y+ + G G + G NAD + Sbjct: 300 PEVLNGVKEREQLFRDGLNAINDKYQ---------VFTEVRGKGLLLGAAL-NADYA--- 346 Query: 362 AQLAKVMEAARARGLLLMPSGKARHIIRLLAPLTIEAEVLEEGLDILEQCLAEL 415 + M AA G+LL+ +G ++++R L I + EGL + +A+L Sbjct: 347 GKARDFMLAAAEEGVLLLMAG--QNVVRFAPSLIIPEADVREGLARFDAAIAKL 398 Lambda K H 0.320 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 427 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 416 Length of database: 405 Length adjustment: 31 Effective length of query: 385 Effective length of database: 374 Effective search space: 143990 Effective search space used: 143990 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory