Align ThuK aka RB0314 aka SMB20328, component of Trehalose/maltose/sucrose porter (trehalose inducible) (characterized)
to candidate 6936480 Sama_0668 iron(III) ABC transporter, ATP-binding protein (RefSeq)
Query= TCDB::Q9R9Q4 (342 letters) >FitnessBrowser__SB2B:6936480 Length = 341 Score = 191 bits (486), Expect = 2e-53 Identities = 120/342 (35%), Positives = 195/342 (57%), Gaps = 30/342 (8%) Query: 1 MAELQLRDIRKSFGAFDVIKGVSMEIKPGEFMVFVGPSGCGKSTLLRLIAGLEEITSGTL 60 M+ L ++ + + V++G+++ + GE +GPSGCGK+TLLR IAGL++I++G++ Sbjct: 1 MSTLSIQGLHSDYRGEQVLRGLNLTLTQGEITALLGPSGCGKTTLLRTIAGLQDISAGSI 60 Query: 61 AFDGQIVNQ----LTPSRRGIAMVFQSYALYPHMTVYENMAFGMQLAGKDKQQCRKRVEA 116 A +G+ V+ + P +R I M+FQ YAL+PH+TV +N+ FG++ DKQ R+E Sbjct: 61 AINGKTVSADGCFVAPEKRSIGMIFQDYALFPHLTVADNILFGVRQL--DKQSRSVRLEE 118 Query: 117 AAEMLQLTPYLERLPRQLSGGQRQRVAIGRAIVRDPKVFLFDEPLSNLDAALRVATRLEI 176 +++L +R P +LSGGQ+QRV+I RA+ +P + L DEP SN+DA +R A LEI Sbjct: 119 MLSLVKLEGLGKRYPHELSGGQQQRVSIARALAYEPDLLLLDEPFSNIDAQVRRALMLEI 178 Query: 177 AKLHRSMHKTTMIYVTHDQVEAMTLADRICVLRDGLVEQIGTPLELYETPNSVFVAGFIG 236 + ++ + ++VTH + EA AD + + G + Q G P LY++PN+ +VA F+G Sbjct: 179 RAILKA-RNVSAVFVTHSKDEAFAFADTLALFEAGRIVQHGIPETLYQSPNTPYVADFLG 237 Query: 237 SPKMNFLS------------GAFAEP--YKADTIG----IRAEHLEIDEQGGEWSGTVIH 278 + N+L GAF P +KA + +R E L I E + +G ++ Sbjct: 238 A--SNYLDVRLEAGQLISTLGAFPLPQDFKAASETGRWLLRPEQLLI-EARADGAGEILE 294 Query: 279 SEMLGSDSYIYLDIGTGEPVIVRESGIAKHQPGQTIRISPAA 320 LG+ + YL + GE V+ S + G + +S AA Sbjct: 295 RRFLGNGCH-YL-VRLGEQVLDIHSHLGHLACGSRVSLSAAA 334 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 289 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 342 Length of database: 341 Length adjustment: 29 Effective length of query: 313 Effective length of database: 312 Effective search space: 97656 Effective search space used: 97656 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory