Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate 6937060 Sama_1231 peptide ABC transporter, ATP-binding protein (RefSeq)
Query= TCDB::Q9X272 (328 letters) >FitnessBrowser__SB2B:6937060 Length = 261 Score = 196 bits (499), Expect = 4e-55 Identities = 103/251 (41%), Positives = 164/251 (65%), Gaps = 8/251 (3%) Query: 12 PLLQTVDLKKYFPQGKRILK-----AVDGISIEIKEGETLGLVGESGCGKSTLGRTILKL 66 PLL+ L K + G K A+ IS E+ GETL +VGE+G GKSTL R ++ Sbjct: 4 PLLKVTSLSKRYFTGYHRFKRQYNEALAPISFELGRGETLAIVGEAGSGKSTLARILVGA 63 Query: 67 LRPDGGKIFFEGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQMTVGRIIEDPLIIHKI 126 + G I FEG+ +L + +K + +++IFQDP SLNP++++G ++E+PL + Sbjct: 64 EQRSSGDIQFEGE---SLESRNLKQRCRLIRMIFQDPNTSLNPRLSIGELLEEPLRFNTG 120 Query: 127 GTKKERRKRVEELLDMVGIGREFINSFPHEFSGGQQQRIGIARALALNPKFIVCDEPVSA 186 + ER +V E L VG+ E + +PH S GQ+QR+ +ARAL L+PK I+ DE ++A Sbjct: 121 MSAHERSVQVTETLRKVGLLPEHADFYPHMISEGQKQRVAVARALMLSPKVIIADEALTA 180 Query: 187 LDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVDKIFL 246 LD+S+++QI++LL +Q++MG+SY+F++HNL +V H+S K+ V++ G+++E G V K+F Sbjct: 181 LDLSVRSQILNLLLHLQKEMGLSYIFVSHNLNLVRHVSDKIMVLHKGQLIEKGPVQKVFE 240 Query: 247 NPIHPYTRALL 257 +P H YT L+ Sbjct: 241 SPEHEYTARLI 251 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 243 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 261 Length adjustment: 26 Effective length of query: 302 Effective length of database: 235 Effective search space: 70970 Effective search space used: 70970 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory