Align D-mannitol and D-mannose transporter (MFS superfamily) (characterized)
to candidate 6937233 Sama_1403 glucose/galactose transporter (RefSeq)
Query= reanno::SB2B:6936374 (413 letters) >FitnessBrowser__SB2B:6937233 Length = 415 Score = 426 bits (1096), Expect = e-124 Identities = 223/406 (54%), Positives = 293/406 (72%), Gaps = 10/406 (2%) Query: 1 MAFVSSTTPQNGSAAPAQSHQQLLFGAMTSLFFIWGFITALNDILIPHLKGIFDLSYTQA 60 MA V + AA A++++ L G++T+LFF+WGFIT LNDILIPHLK +F L+Y QA Sbjct: 1 MATVPIANANHAGAAGAENYRFAL-GSLTTLFFMWGFITCLNDILIPHLKAVFSLNYAQA 59 Query: 61 MLVQFCFFGAYFLVSPLAGVLIARIGYLRGIIFGLSTMATGCLLFYPASSLEQYALFLLA 120 ML+QFCFFGAYFLVS AGVL+ R+GY +GI+ GL T A GC LFYPA+ Y +FL A Sbjct: 60 MLIQFCFFGAYFLVSVPAGVLVKRLGYQKGIVVGLLTAALGCGLFYPAAVSATYGVFLGA 119 Query: 121 LFVLASGITILQVSANPFVARLGPERTAASRLNLAQALNSLGHTLGPLFGSLLIFGAAAG 180 LFVLASGIT+LQV+ANP+V LGP +TA+SRL L QA NSLG T+ P FGS+LI A G Sbjct: 120 LFVLASGITVLQVAANPYVTALGPVQTASSRLTLTQAFNSLGTTIAPAFGSVLILSVAVG 179 Query: 181 TH-----EAVQLPYLLLAAVIGIIAVGFIFLGGKVKHADMGVDH--RHKGSLLSHKRLLL 233 +AV+LPYLLL ++ ++AV F L K+ H D S L+H+ L+L Sbjct: 180 ASAEAEADAVKLPYLLLCGMLIVLAVVFALL--KLPHIHDQEDEVAATGQSALAHRHLVL 237 Query: 234 GALAIFLYVGAEVSIGSFLVNYFAEPSIGGLDEKSAAELVSWYWGGAMIGRFAGAALTRR 293 GA+ IF+YVG EV+IGSFLVN+ E + G+ E AA +++YWGGAM+GRF GAA+ ++ Sbjct: 238 GAIGIFVYVGGEVAIGSFLVNFLGESHVAGMAEADAAHYIAFYWGGAMVGRFIGAAVMQK 297 Query: 294 FNPAMVLAANAVFANLLLMLTIVSSGELALVAVLAVGFFNSIMFPTIFTLAIEGLGELTS 353 + VL NA A LL+++ + SSG LA+ A+LAVG FNSIMFPTIF+LA++ LG T+ Sbjct: 298 VDAGKVLGFNATMAALLVLVAMNSSGALAMWAILAVGLFNSIMFPTIFSLALKNLGPATA 357 Query: 354 RGSGLLCQAIVGGALLPVIQGVVADNVGVQLSFIVPTFCYFYICWY 399 +GSG+LC AIVGGAL+P++QG++AD+VG+ SFI+P CY YI +Y Sbjct: 358 QGSGILCLAIVGGALVPLLQGLLADSVGLSASFILPVLCYGYILFY 403 Lambda K H 0.329 0.142 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 513 Number of extensions: 17 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 413 Length of database: 415 Length adjustment: 31 Effective length of query: 382 Effective length of database: 384 Effective search space: 146688 Effective search space used: 146688 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory