Align cyclohexa-1,5-dienecarbonyl-CoA hydratase (EC 4.2.1.100) (characterized)
to candidate 6937208 Sama_1378 enoyl-CoA hydratase (RefSeq)
Query= BRENDA::D3RXI0 (252 letters) >FitnessBrowser__SB2B:6937208 Length = 257 Score = 111 bits (277), Expect = 2e-29 Identities = 76/247 (30%), Positives = 126/247 (51%), Gaps = 11/247 (4%) Query: 15 ARIKIANPPVNVLDMETMKEIISAIDEVEG---VDVIVFSGEG-KSFSAGAEIKEHFPD- 69 A + I+NPP N E++ E+ + E+ + +V +GEG K FSAGA++K F D Sbjct: 13 AILTISNPPANTWTRESLNELKEKVLELNDNNEIYALVLTGEGEKFFSAGADLKL-FADG 71 Query: 70 ---KAPEMIRWFTQLIDKVLRCKAITVAAVKGFALGGGFELAIACDFVLASKNAKLGVPE 126 A M + F + + + + +++AA+ G+A+GGG E+A+ACD +A A + +PE Sbjct: 72 DKGNAATMAKAFGEAFETLSAFRGVSIAAINGYAMGGGLEVALACDIRIAEIQAVMALPE 131 Query: 127 ITLAHYPPV-AIALLPRMIGWKNAYELILTGEAITAERAFEIGLVNKVFEDENFEESVND 185 T+ P L ++G A +IL GE I A +A +GLV +V E + Sbjct: 132 ATVGLLPCAGGTQNLTALVGEGWAKRMILCGERIDATKALNLGLVEEVVEKGESLSAAIA 191 Query: 186 FVNSLLEKSSVALRLTKKALLFSTEKEYLSLFDVINDVYLSQLVKSEDAVEGLKAFLEKR 245 + ++S A+ + KK + + ++++ L +ED EG+ AFLEKR Sbjct: 192 LAAKVAKQSPSAVAVCKKLIQSGRNMPRTQALPLERELFVG-LFDTEDQAEGVNAFLEKR 250 Query: 246 KPEWKGR 252 +WK R Sbjct: 251 AAQWKNR 257 Lambda K H 0.318 0.136 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 168 Number of extensions: 11 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 252 Length of database: 257 Length adjustment: 24 Effective length of query: 228 Effective length of database: 233 Effective search space: 53124 Effective search space used: 53124 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory