Align pimeloyl-CoA dehydrogenase large subunit (EC 1.3.1.62) (characterized)
to candidate 6937192 Sama_1362 isovaleryl-CoA dehydrogenase (RefSeq)
Query= metacyc::MONOMER-20676 (396 letters) >FitnessBrowser__SB2B:6937192 Length = 389 Score = 95.5 bits (236), Expect = 2e-24 Identities = 64/200 (32%), Positives = 99/200 (49%), Gaps = 16/200 (8%) Query: 62 KEYGGTGWSSVQHYIFNEELQAAPAPQPLAFGV--SMVGPVIYTFGSEEQKKRFLPRIAN 119 +EYGG + H + EE+ A A L++G ++ IY G+E Q+ ++LP++ + Sbjct: 64 EEYGGVNMGYLAHVVAMEEISRASASIGLSYGAHSNLCVNQIYRNGNEAQRAKYLPKLIS 123 Query: 120 VDDWWCQGFSEPGSGSDLASLKTKAEKKGDKWIINGQKTWTTLAQHADWIFCLCRTDPAA 179 + SEP +GSD+ S+K A K+GD++I+NG K W T A +TD Sbjct: 124 GEHIGALAMSEPNAGSDVVSMKLHARKEGDRYILNGNKMWITNGPDAHTYVIYAKTD-LD 182 Query: 180 KKQEGISFILVDMKTKGITVRPIQTID----GGHEVNEVFFDDVEVPLENLVGQEN---- 231 K GI+ +V+ KG + Q +D G E+ F+D EVP EN++G N Sbjct: 183 KGPHGITAFIVERGFKGFS--QAQKLDKLGMRGSNTCELVFEDCEVPEENILGGLNNGVK 240 Query: 232 ---KGWDYAKFLLGNERTGI 248 G DY + +L GI Sbjct: 241 VLMSGLDYERVVLSGGPLGI 260 Lambda K H 0.317 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 22 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 396 Length of database: 389 Length adjustment: 31 Effective length of query: 365 Effective length of database: 358 Effective search space: 130670 Effective search space used: 130670 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory