Align 3-oxoadipyl-CoA thiolase; EC 2.3.1.174 (characterized, see rationale)
to candidate 6937205 Sama_1375 Acetyl-CoA C-acetyltransferase (RefSeq)
Query= uniprot:A0A2Z5MFE9 (400 letters) >FitnessBrowser__SB2B:6937205 Length = 392 Score = 257 bits (656), Expect = 5e-73 Identities = 152/398 (38%), Positives = 231/398 (58%), Gaps = 9/398 (2%) Query: 1 MNDAYICDAIRTPIGRYGGALKDVRADDLGAVPIKALIQRNPGVDWRAVDDVIYGCANQA 60 ++D I A RT +G + G+L +V + L A +KAL+ + G+D VD+++ GC A Sbjct: 3 VSDIVIVAAKRTAMGGFQGSLSEVPSPKLAATAVKALLD-DTGLDGARVDELLMGCVLPA 61 Query: 61 GEDNRNVARMSALLAGLPADAPGATINRLCGSGMDAVGTAARAIKAGEAQLMIAGGVESM 120 G + AR +AL AGLP T+N++CGSGM V A IKAG A+++IAGG+ESM Sbjct: 62 GL-GQAPARQAALGAGLPLSVGATTVNKVCGSGMKTVMLAHDLIKAGSAKVVIAGGMESM 120 Query: 121 TRAPFVMGKAASAFTRQAEIHDTTIGWRFVNPLMKRQYGVDSMPETAENVAEQFGISRAD 180 ++AP+++ KA H + F++ L + Y +M A+ A+ +G++R Sbjct: 121 SQAPYLLDKARGGMRMG---HGKVLDHMFLDGL-EDAYTGGAMGTFAQKTADDYGLTRES 176 Query: 181 QDAFALASQQKAARAQRDGTLAQEIVGVEIAQKKGDAIRVTLDEHPRETSLESLARLKGV 240 DAFAL+S +KA A G EIV V ++ +KGD + V +DE P E + L+ Sbjct: 177 MDAFALSSLEKANAAINSGAFEAEIVPVTVSSRKGD-VEVKVDEQPGNARPEKIPTLRPA 235 Query: 241 VRPDGTVTAGNASGVNDGACALLIASQQAAEQYGLRRRARVVGMATAGVEPRIMGIGPAP 300 DGT+TA N+S ++DGA AL++ S+ A+ GL+ A + G T EP + P Sbjct: 236 FAKDGTITAANSSSISDGAAALMLMSRDQADALGLKVLATIKGHTTHAQEPAMFTTAPVG 295 Query: 301 ATQKLLRQLGMTLDQLDVIELNEAFASQGLAVLRMLGLRDDDPRVNPNGGAIALGHPLGA 360 A KLL +G + D++D+ E+NEAFA + +L + L+ D RVN NGGA ALGHP+G Sbjct: 296 AMTKLLSNVGWSKDEVDLFEINEAFAM--VTMLAISELKLDAARVNVNGGACALGHPIGC 353 Query: 361 SGARLVTTALHQLERSNGRFALCTMCIGVGQGIALVIE 398 SGAR++ T +H L+ + + ++CIG G+ A+ IE Sbjct: 354 SGARVLVTLIHALKARGLKRGVASLCIGGGEATAMAIE 391 Lambda K H 0.319 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 387 Number of extensions: 19 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 392 Length adjustment: 31 Effective length of query: 369 Effective length of database: 361 Effective search space: 133209 Effective search space used: 133209 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory