GapMind for catabolism of small carbon sources


Alignments for a candidate for gabT in Shewanella amazonensis SB2B

Align 4-aminobutyrate aminotransferase; EC (characterized, see rationale)
to candidate 6938533 Sama_2636 4-aminobutyrate aminotransferase (RefSeq)

Query= uniprot:A1S8Y2
         (425 letters)

          Length = 425

 Score =  835 bits (2157), Expect = 0.0
 Identities = 425/425 (100%), Positives = 425/425 (100%)








Query: 421 AVLGK 425
Sbjct: 421 AVLGK 425

Lambda     K      H
   0.319    0.136    0.391 

Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 722
Number of extensions: 6
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 425
Length of database: 425
Length adjustment: 32
Effective length of query: 393
Effective length of database: 393
Effective search space:   154449
Effective search space used:   154449
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 51 (24.3 bits)

Align candidate 6938533 Sama_2636 (4-aminobutyrate aminotransferase (RefSeq))
to HMM TIGR00700 (gabT: 4-aminobutyrate transaminase (EC

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020);
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00700.hmm
# target sequence database:        /tmp/gapView.3126.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00700  [M=420]
Accession:   TIGR00700
Description: GABAtrnsam: 4-aminobutyrate transaminase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
     2e-161  523.2   4.2   2.3e-161  523.0   4.2    1.0  1  lcl|FitnessBrowser__SB2B:6938533  Sama_2636 4-aminobutyrate aminot

Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__SB2B:6938533  Sama_2636 4-aminobutyrate aminotransferase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  523.0   4.2  2.3e-161  2.3e-161       2     417 ..      11     418 ..      10     421 .. 0.98

  Alignments for each domain:
  == domain 1  score: 523.0 bits;  conditional E-value: 2.3e-161
                         TIGR00700   2 rraaavskGvgvtlrvlaakaegaelkdvdGnrlidlaagiavlnvGhshPkvveavkrqveelthtafqvvpyesy 78 
                                       rr aav+ Gvg   +v++ +ae+a++ dv+G+++id+a+giavln+Gh hPkv +av +q+e++ ht+f+v+ yesy
                                       899************************************************************************** PP

                         TIGR00700  79 velaeklnaiaPgsgekkavllnsGaeavenavkiarkytgrpgvvafsrgfhGrtnltmaltakvkPykiGfGPfa 155
                                       v++ ekln++ Pg   kk++l++sG+eavena+k+ar+yt+r gv+af+ g+hGrt  ++alt+kv+Py  G+G + 
                                       ***************************************************************************** PP

                         TIGR00700 156 pevyraPlpydyrdialdkqeslddelaaiealfvadveaeqvaavvlePvqGeGGfivpakelvaavaslckehgi 232
                                       ++v+ra +p  +++ +       dd +a+ie++f+ d e+ ++aa++lePvqGeGGf  ++ ++++ +++lc+++gi
                                       *************9987......77888************************************************* PP

                         TIGR00700 233 vliadevqtGfartGklfaieheddkPdlitvaksladGlPlsgvvGraeildapapGglGGtyaGnPlavaaalav 309
                                       +liadevqtG  rtG++fa+e +++  d+ t aks+a+G+Plsg++Grae++da  pGglGGty+G+Pla+aaalav
                                       ***************************************************************************** PP

                         TIGR00700 310 ldiieeeglieraeqigklvkdklielkeevpaigdvrglGamiavelvdpdttePdaalaekiaaaalaaGllllt 386
                                       +++ eee l er++ ig+ +k  + el    p+i++vrglG+mia+el++++   P    + ++ ++a+++Gl+ll+
                                       ************************************************98876555..5778999************ PP

                         TIGR00700 387 aGifGniirlltPltisdelldeglkileaa 417
                                       +G +Gn++r+l P+t +de+++ gl+i+ + 
  lcl|FitnessBrowser__SB2B:6938533 388 CGTYGNVLRILVPITAPDEQIQRGLEIMAEC 418
                                       ***************************9876 PP

Internal pipeline statistics summary:
Query model(s):                            1  (420 nodes)
Target sequences:                          1  (425 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 11.84

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.



Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory