Align L-serine dehydratase, alpha chain; Short=SDH; EC 4.3.1.17 (characterized, see rationale)
to candidate 6938668 Sama_2771 L-serine ammonia-lyase (RefSeq)
Query= uniprot:P33073 (292 letters) >FitnessBrowser__SB2B:6938668 Length = 464 Score = 130 bits (326), Expect = 7e-35 Identities = 95/282 (33%), Positives = 136/282 (48%), Gaps = 18/282 (6%) Query: 5 AREIIDVCNERGIKIYDLVLEEEIKNSHTTEEEIRKKLDAVIDVMHASATKNLTQSDVTE 64 A ++ +C G+ I L+L E K+ H+ E R D + + A T+ + Sbjct: 182 AERLVQLCRAEGVSISTLMLANE-KDCHSEEYIYRGFRDIWLTMKQAIDRGCHTEGVLAG 240 Query: 65 YKMIDGFAKRTYEYANSGKSIVGD---FLAKAMAMAFSTSEVNASMGKIVAAPTAGSSGI 121 + A + + I D + A + SE NA+ G++V APT G++GI Sbjct: 241 PLRVPRRAPALLKQLETSGRISADPMEIVDWVNLFALAVSEENAAGGRVVTAPTNGAAGI 300 Query: 122 MPAMLVAATEKYNFDRTTIQNG-------FLTSIGIGQVITKYATFAGAEGGCQAECGSA 174 +PA++ FDR G L S IG + + A+ +GAE GCQ E G A Sbjct: 301 IPAVMAY------FDRFIQPLGQKEYSRFLLASAAIGSLYKRNASISGAEVGCQGEVGVA 354 Query: 175 SAMAAAALVEMLGGTVEQALHAASITIINVLGLVCDPIAGLVQYPCTFRNASGVINAFIS 234 +MAAA L E++G + Q AA I + + LGL CDP+AG VQ PC RNA + A + Sbjct: 355 CSMAAAGLAELMGASPAQVCMAAEIAMEHNLGLTCDPVAGQVQVPCIERNAIAAVKAVNA 414 Query: 235 ADLALAGV-ESLVPFDEVVIAMGEVGNSMIEALRETGLGGLA 275 A +AL + V D+V+ M E G M RET LGGLA Sbjct: 415 ARMALRRTSDPRVSLDKVIATMYETGKDMHAKYRETSLGGLA 456 Lambda K H 0.317 0.132 0.361 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 464 Length adjustment: 30 Effective length of query: 262 Effective length of database: 434 Effective search space: 113708 Effective search space used: 113708 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory