Align TRAP-type C4-dicarboxylate:H+ symport system substrate-binding component DctP (characterized, see rationale)
to candidate 6938088 Sama_2209 C4-dicarboxylate-binding periplasmic protein (RefSeq)
Query= uniprot:Q8ECK4 (339 letters) >FitnessBrowser__SB2B:6938088 Length = 339 Score = 523 bits (1347), Expect = e-153 Identities = 258/327 (78%), Positives = 290/327 (88%) Query: 13 LKTVAKMLALASVFATSFNVFAAPVEIKFSHVVAENTPKGQMALKFKELVEQRLPGEYTV 72 L T+ K LA+V SF A PVEIKFSHVVAENTPKGQMALKFKELVE RLPGEY V Sbjct: 12 LFTLGKASLLATVLGFSFGAVAEPVEIKFSHVVAENTPKGQMALKFKELVESRLPGEYKV 71 Query: 73 SVFPNSQLFGDNNELAALLLNDVQFVAPSLSKFERYTKRLQVFDLPFLFNDMDAVNRFQQ 132 SVFPNSQLFGDNNELAALLLNDVQ VAPSLSKFERYTK+LQVFDLPFLF DMDAV+RFQQ Sbjct: 72 SVFPNSQLFGDNNELAALLLNDVQLVAPSLSKFERYTKKLQVFDLPFLFEDMDAVDRFQQ 131 Query: 133 GEAGQALLNSMSRKGIVGLGYLHNGMKQFTANTPLKQPSDAKGLKFRVMASDVLAAQFDA 192 EAGQ LLNSMSRKG+VGLGYLHNGMKQF+AN L P DA G KFR+M SDV+AAQF+A Sbjct: 132 SEAGQQLLNSMSRKGLVGLGYLHNGMKQFSANNALSLPGDAAGKKFRIMPSDVIAAQFEA 191 Query: 193 VGAIPVKKPFSEVFTLLQTRAIDGQENTWSNTYSQKFYEVQSHITESNHGVLDYMVVTSD 252 VGAIPVKKPFSEVFTLLQTRAIDGQENTWSN YS+KFYEVQ+HITESNHGVLDYM+VTS+ Sbjct: 192 VGAIPVKKPFSEVFTLLQTRAIDGQENTWSNIYSKKFYEVQTHITESNHGVLDYMLVTSE 251 Query: 253 AFWKSLPADKRKVIKEALDESIALGNKIAAEKDNEDKQLILDSKLSQLVTLSPAERQQWV 312 FWKSLP DKR++IK+++DE++ALGNK+A EK NED+QLILDSK +LVTL+P +RQ WV Sbjct: 252 TFWKSLPKDKREIIKQSMDEAVALGNKLALEKANEDRQLILDSKRVELVTLTPEQRQAWV 311 Query: 313 DVMKPVWSKFEDQVGKDVIEAAVAANK 339 + M+PVWS+FED++GKD+IEAA +ANK Sbjct: 312 NAMRPVWSQFEDKIGKDLIEAAESANK 338 Lambda K H 0.317 0.131 0.369 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 15 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 339 Length adjustment: 28 Effective length of query: 311 Effective length of database: 311 Effective search space: 96721 Effective search space used: 96721 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory