GapMind for catabolism of small carbon sources

 

Aligments for a candidate for ams in Shewanella amazonensis SB2B

Align Alpha-glucosidase; EC 3.2.1.20 (characterized, see rationale)
to candidate 6937506 Sama_1662 alpha amylase, catalytic region (RefSeq)

Query= uniprot:H3K096
         (538 letters)



>lcl|FitnessBrowser__SB2B:6937506 Sama_1662 alpha amylase, catalytic
           region (RefSeq)
          Length = 544

 Score =  640 bits (1651), Expect = 0.0
 Identities = 293/503 (58%), Positives = 363/503 (72%), Gaps = 5/503 (0%)

Query: 7   WWRGGVIYQIYPRSFLDSRGDGVGDLNGITEKLDYVASLNVDGIWLSPFFTSPMLDFGYD 66
           WWRG  IYQIYPRS  DS GDG+GDL GI E+LDY+ASLNVD IW+SPFF SPM DFGYD
Sbjct: 6   WWRGAAIYQIYPRSLKDSNGDGIGDLQGIIERLDYIASLNVDAIWISPFFRSPMKDFGYD 65

Query: 67  VSDYRDVDPMFGTLEDFKALLEKAHSLGLKVMIDQVISHTSDQHPWFQESRQNRTNPKAD 126
           +SDY DVDPMFGT++DF  L+ KAHSLGLKV+IDQV+SHTSD+H WF ESRQ+R NPKAD
Sbjct: 66  ISDYLDVDPMFGTMDDFDELIAKAHSLGLKVVIDQVLSHTSDEHAWFAESRQSRDNPKAD 125

Query: 127 WFVWADPKPDGTPPNNWLSIFGGSAWTFDSRRQQYYLHNFLTSQPDVNFHHPEARQAQLD 186
           W+VWADP+ DGTPPNNWL+IFGG AW ++ RRQQYYLHNFL SQPD+NFH    RQA L+
Sbjct: 126 WYVWADPREDGTPPNNWLAIFGGCAWEWEPRRQQYYLHNFLKSQPDLNFHCEAVRQAVLN 185

Query: 187 NMRFWLDLGVDGFRLDTVNFYFHDAELRDNPPVPKGEAKTLGAPEANPYTWQRHVYDLSR 246
           N+ FWL  GVDGFRLD + F FHD  LRDNP  P  + +  G  E NPY +Q H Y+  R
Sbjct: 186 NVEFWLKKGVDGFRLDAITFCFHDKALRDNPAKPADKRQGRGFSEDNPYAYQYHWYNNER 245

Query: 247 PENLDFLKDLRALMDEYPGTTTVGEIGDDNPLERMAEYTAGGDKLHMAYTFDLLNMPHSA 306
           PE L F++DLRAL+D YPG  T+GE+  ++ L  MAEYT G ++LHMAY+F+LL   +SA
Sbjct: 246 PETLGFIEDLRALIDRYPGAVTLGEVSSEDSLATMAEYTRGDNRLHMAYSFELLTKDYSA 305

Query: 307 SYLREVIERFQRLAGDAWPCWATSNHDVVRSATRWGADEDPHAYPKVMLAVLFSLRGSVC 366
            Y+R  +E  +   GD WPCWA  NHDV R  +RWG  +      K++ A+L  LRGS+C
Sbjct: 306 GYIRSTVEALEGAIGDGWPCWAIGNHDVERVISRWGQGKGTPQMAKMLSAMLGCLRGSLC 365

Query: 367 LYQGEELGLPEADVPFERIQDPYGKVLWPEFKGRDGCRTPMPW-TDGEQGGF----SPVE 421
           +YQGEELGL EAD+PF+ +QDP+G   WP FKGRDGCRTPMPW  +GE  GF    S   
Sbjct: 366 VYQGEELGLTEADIPFDALQDPFGIAFWPNFKGRDGCRTPMPWQAEGEYMGFGATASGAM 425

Query: 422 PWLPMEARHLELAVSRQQDDPNATLNTVRALLAFRRSHPALFDGDLSLVDVGDDLLGFTR 481
           PWLP+   H  L V+ Q  +P++ LN     +A+RR+ PAL  G++  +D  + +L F R
Sbjct: 426 PWLPLPEEHRALNVAAQSANPDSVLNQFSRFMAWRRTQPALVTGEIKFIDSKEPVLAFER 485

Query: 482 QKGDETLLCVFNLTGQEQQTTLP 504
              D+ +LCVFNL+ + Q  T+P
Sbjct: 486 VSSDKKVLCVFNLSDKPQTMTVP 508


Lambda     K      H
   0.320    0.138    0.443 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1032
Number of extensions: 46
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 538
Length of database: 544
Length adjustment: 35
Effective length of query: 503
Effective length of database: 509
Effective search space:   256027
Effective search space used:   256027
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory