GapMind for catabolism of small carbon sources

 

Aligments for a candidate for galU in Shewanella amazonensis SB2B

Align UTP--glucose-1-phosphate uridylyltransferase; EC 2.7.7.9 (characterized)
to candidate 6938102 Sama_2223 UTP--glucose-1-phosphate uridylyltransferase (RefSeq)

Query= CharProtDB::CH_021667
         (302 letters)



>lcl|FitnessBrowser__SB2B:6938102 Sama_2223 UTP--glucose-1-phosphate
           uridylyltransferase (RefSeq)
          Length = 302

 Score =  418 bits (1075), Expect = e-122
 Identities = 211/293 (72%), Positives = 241/293 (82%), Gaps = 2/293 (0%)

Query: 6   TKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSK 65
           TK++KAVIPVAGLGTRMLPATKAIPKEMLP+VDKPLIQYVV+E +AAGI EIVLVTH+SK
Sbjct: 4   TKIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAVAAGIKEIVLVTHASK 63

Query: 66  NSIENHFDTSFELEAMLEKRVKRQLLDEVQSICPPHVTIMQVRQGLAKGLGHAVLCAHPV 125
           NSIENHFDTSFELEA LE+RVKRQLLDEVQ+ICP  VT++ VRQ  AKGLGHA+LCA PV
Sbjct: 64  NSIENHFDTSFELEAQLERRVKRQLLDEVQAICPKDVTVISVRQAQAKGLGHAILCARPV 123

Query: 126 VGDEPVAVILPDVILDEYESDLSQDNLAEMIRRFDETGHSQIMVEPVAD--VTAYGVVDC 183
           VGDEP AV+LPDVI+D  +SDL+ +NLA M+R FDET   QIMVE V    V  YG+ D 
Sbjct: 124 VGDEPFAVLLPDVIIDGAKSDLTSENLAAMVRLFDETSTGQIMVEAVPHEMVNQYGIADV 183

Query: 184 KGVELAPGESVPMVGVVEKPKADVAPSNLAIVGRYVLSADIWPLLAKTPPGAGDEIQLTD 243
           KG ++  G+SVP+  +VEKP  D APSNLA+VGRYVL ADIWPLLA+TP GAGDEIQLTD
Sbjct: 184 KGHQMVNGDSVPLEALVEKPAVDEAPSNLAVVGRYVLPADIWPLLARTPAGAGDEIQLTD 243

Query: 244 AIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEFKAWLEE 296
           AI ML+E   V AY M GKSHDCGNK GYMQA VEY +RH  LG EF  +L++
Sbjct: 244 AIAMLMESAQVNAYGMVGKSHDCGNKQGYMQANVEYALRHPELGKEFAKYLKQ 296


Lambda     K      H
   0.317    0.135    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 378
Number of extensions: 19
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 302
Length of database: 302
Length adjustment: 27
Effective length of query: 275
Effective length of database: 275
Effective search space:    75625
Effective search space used:    75625
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 48 (23.1 bits)

Align candidate 6938102 Sama_2223 (UTP--glucose-1-phosphate uridylyltransferase (RefSeq))
to HMM TIGR01099 (galU: UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR01099.hmm
# target sequence database:        /tmp/gapView.3808.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01099  [M=261]
Accession:   TIGR01099
Description: galU: UTP--glucose-1-phosphate uridylyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                         Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                         -----------
   1.8e-115  371.0   0.2   2.1e-115  370.8   0.2    1.0  1  lcl|FitnessBrowser__SB2B:6938102  Sama_2223 UTP--glucose-1-phospha


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__SB2B:6938102  Sama_2223 UTP--glucose-1-phosphate uridylyltransferase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  370.8   0.2  2.1e-115  2.1e-115       1     261 []       6     275 ..       6     275 .. 0.97

  Alignments for each domain:
  == domain 1  score: 370.8 bits;  conditional E-value: 2.1e-115
                         TIGR01099   1 irkaviPaaGlGtrlLPatkaiPkemlpivdkPliqyvveeaveaGieeivlvtgrskraiedhfDtsyeleaklek 77 
                                       irkaviP+aGlGtr+LPatkaiPkemlp+vdkPliqyvv eav+aGi+eivlvt+ sk++ie+hfDts+elea+le+
  lcl|FitnessBrowser__SB2B:6938102   6 IRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAVAAGIKEIVLVTHASKNSIENHFDTSFELEAQLER 82 
                                       89*************************************************************************** PP

                         TIGR01099  78 knkeellkevrkiael.atilyvrqkeakGLGhavllaeelvgdepfavllgDdlvseeee.....alkqlielyek 148
                                       + k++ll+ev++i+++ +t++ vrq +akGLGha+l+a+++vgdepfavll+D++++  ++     +l+ +++l+++
  lcl|FitnessBrowser__SB2B:6938102  83 RVKRQLLDEVQAICPKdVTVISVRQAQAKGLGHAILCARPVVGDEPFAVLLPDVIIDGAKSdltseNLAAMVRLFDE 159
                                       ***************99***************************************98877788889********** PP

                         TIGR01099 149 tgasiiaveevpkeevskYGvidgee...veeelyevkdlvekPkpeeapsnlaivGrYvltpeifelleetkaGkg 222
                                       t + +i+ve vp+e v++YG++d+++   v+ + + +++lvekP ++eapsnla+vGrYvl ++i+ ll++t+aG+g
  lcl|FitnessBrowser__SB2B:6938102 160 TSTGQIMVEAVPHEMVNQYGIADVKGhqmVNGDSVPLEALVEKPAVDEAPSNLAVVGRYVLPADIWPLLARTPAGAG 236
                                       *********************998763347788888***************************************** PP

                         TIGR01099 223 geiqltDalrlllekeevlavklkgkryDvGdklgylka 261
                                       +eiqltDa+++l+e+ +v a+ + gk++D+G+k+gy++a
  lcl|FitnessBrowser__SB2B:6938102 237 DEIQLTDAIAMLMESAQVNAYGMVGKSHDCGNKQGYMQA 275
                                       *************************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (261 nodes)
Target sequences:                          1  (302 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01
# Mc/sec: 7.28
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory