Align glucose transporter, ATPase component (characterized)
to candidate 6938073 Sama_2206 ABC transporter, ATP-binding/permease protein, putative (RefSeq)
Query= reanno::Phaeo:GFF3641 (260 letters) >FitnessBrowser__SB2B:6938073 Length = 612 Score = 95.9 bits (237), Expect = 2e-24 Identities = 74/237 (31%), Positives = 121/237 (51%), Gaps = 14/237 (5%) Query: 3 TAKELRAAGATPLVEMKDISISFG-GIKAVDHVSVDLYPGEVVGLLGHNGAGKSTLIKVL 61 TAK L+ + KD+S +G G +D + +++ PGE VGL+G +GAGKST++ +L Sbjct: 353 TAKALQVNNGA--IHYKDVSFHYGEGSGVIDGLELNIRPGEKVGLVGRSGAGKSTMVNLL 410 Query: 62 SGAYQMDAGEIRVNGDKVEITNPRDARSHNIETIYQTLALADNLDAASNLFLGRELVTPF 121 Y ++ GEI ++G + R+H I + Q +L + N+ GR T Sbjct: 411 MRFYDVERGEILIDGQPINEVTQDSLRAH-IGMVTQDTSLL-HRTIRENILYGRPDATED 468 Query: 122 GLVDDSAMEAECRKIMNRLNPNF------QKFSEPVSALSGGQRQSVAIARAVYFNAKIL 175 L + + A+ R+ + +L+ E LSGGQRQ +AIAR + +A IL Sbjct: 469 EL-NKAIDRAQAREFIEQLSDPSGNHGLDAMVGERGVKLSGGQRQRIAIARVLLKDAPIL 527 Query: 176 IMDEPTAALGPHETQMVAELIQQLKAQGIGIFLIDHDVNAVMELCDRASVMKNGQLV 232 I+DE T+AL + E + QL +G + I H ++ + + DR V+ G++V Sbjct: 528 ILDEATSALDSEVEAAIQESLYQL-MEGKTVIAIAHRLSTIAAM-DRLIVLDEGKVV 582 Lambda K H 0.317 0.135 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 254 Number of extensions: 11 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 612 Length adjustment: 31 Effective length of query: 229 Effective length of database: 581 Effective search space: 133049 Effective search space used: 133049 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory