Align D-lactate dehydrogenase (EC 1.1.1.28) (characterized)
to candidate 6938846 Sama_2949 D-3-phosphoglycerate dehydrogenase (RefSeq)
Query= BRENDA::A0A0M3KL04 (335 letters) >FitnessBrowser__SB2B:6938846 Length = 409 Score = 131 bits (330), Expect = 3e-35 Identities = 90/229 (39%), Positives = 125/229 (54%), Gaps = 9/229 (3%) Query: 79 GYDMIDLEQASERGLVVTNVPAYSPNSVAELALTQTMRLIRNLPLFDARGAEQDFRWAGL 138 G + +DL+ A G+ V N P + SVAEL L + + L+R +P +A + + Sbjct: 85 GTNQVDLKSAELAGIPVFNAPFSNTRSVAELVLGEIIMLMRGIPQRNALCHRGGWLKSAN 144 Query: 139 MAREIRSLTVGIIGAGRIGGTVARLFKALGATVIANDIVERVELKDIVTYVSKEELLQAA 198 + E+R T+G+IG G IG + L + LG V DI +++ L + S EELL A Sbjct: 145 GSVEVRGKTLGVIGYGHIGTQLGILAETLGMRVKFFDIEDKLPLGNAQQVHSFEELLANA 204 Query: 199 DVVTLHVPLMDSTTQLIDADALALMKNDAVLINASRGPVVDTDALIAALQNKQIAGAALD 258 DVV+LHVP T +I LA MK + LINASRG VVD DAL AAL+ + IAGAA+D Sbjct: 205 DVVSLHVPETPQTKNMIGHTELATMKKGSFLINASRGTVVDIDALSAALKEEHIAGAAID 264 Query: 259 TLNGEEHFFNQDLCGKELPSEQLKVLRTLPNVLITPHIGFYTNKAVQNM 307 E N D+ LR L NV++TPH+G T +A +N+ Sbjct: 265 VFPVEPK-SNDDVFQSP--------LRGLDNVILTPHVGGSTEEAQENI 304 Lambda K H 0.317 0.133 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 262 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 335 Length of database: 409 Length adjustment: 30 Effective length of query: 305 Effective length of database: 379 Effective search space: 115595 Effective search space used: 115595 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory