Align Iron-sulfur cluster-binding protein (characterized, see rationale)
to candidate 6938323 Sama_2442 iron-sulfur cluster-binding protein (RefSeq)
Query= uniprot:Q726S3 (717 letters) >FitnessBrowser__SB2B:6938323 Length = 466 Score = 254 bits (648), Expect = 9e-72 Identities = 155/418 (37%), Positives = 219/418 (52%), Gaps = 24/418 (5%) Query: 35 RASRANAFKDIDE-KAIIAEVADAKDHAAKNMDTLYAQFKAEAEKRGVKVHLARTAAEAN 93 R R A + E + + A + K H + F+A+ +GVKVH A+ AE N Sbjct: 33 REKRDRAASSLPEWETLRALGSQIKLHTLNQLPGYLEAFEAKCLSQGVKVHWAKDGAEHN 92 Query: 94 EIIARIARDNNCKKAIKSKSMTAEETHLNHRLEEDNVEVIETDLGEWIIQMRHEGPSHMV 153 I+ I + KK +KSKSM EE HLN LE +EVI+TDLGE IIQ+ H+ PSH+V Sbjct: 93 RIVHDILSRHGVKKLVKSKSMLTEECHLNPFLEGKGIEVIDTDLGERIIQLNHQPPSHIV 152 Query: 154 MPAIHLSRYQVADLFSE-VTKQKQEVDIQRLVKVARRELRTHFATADMGISGANFAVAET 212 +PAIH+ + +V DLF E + K E D RL + AR LR F +AD ++G N AVA Sbjct: 153 VPAIHMKKEEVGDLFHEKLGTPKGESDPTRLTRAARAHLREQFLSADAAMTGVNMAVASE 212 Query: 213 GTIGLVTNEGNARLVTTLPRVHVALAGLDKLVPTLHDALRSLKVLPRNATGQAITSYVTW 272 G + + TNEGNA + LP++ + G+DK+VP L A L++L RNATGQ IT+Y Sbjct: 213 GAVIVCTNEGNADMGANLPKLQLHSMGIDKIVPDLDSAAVLLRMLARNATGQPITTY--- 269 Query: 273 IGGANECEACVDGRKEMHIVFLDNGRRALAEDPLFSQVLRCVRCGACANVCPVYRLVGGH 332 + EMH++ +DNGR A+ D L + L+C+RCG C N CPVYR GG+ Sbjct: 270 ----SSLYRTPKPGGEMHVIIVDNGRSAMMRDKLLGEALKCIRCGGCLNTCPVYRRSGGY 325 Query: 333 KMGHIYIGAIGLILTYFFHGRDKARNLVQNCINCESCKHICAGGIDLPRLIKEIRARLNE 392 GH G IG+ + D + C C SC +C + L ++I R E Sbjct: 326 SYGHTIPGPIGIAVG---ADEDDTHSSPWACTLCGSCSFVCPTKVPLDKIIFHRRRLYAE 382 Query: 393 EEGMPVETT----LMGKMLKNRKLFHTLLRFAKWA--------QKPVTGGTPYIRHLP 438 + +P + L+G+ + + L T + A+ A KP++G R LP Sbjct: 383 RKSLPYGKSGYMPLVGRFMASPLLLDTGMAAARIALKILPHSLLKPMSGAWGKYRELP 440 Lambda K H 0.321 0.135 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 755 Number of extensions: 36 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 717 Length of database: 466 Length adjustment: 36 Effective length of query: 681 Effective length of database: 430 Effective search space: 292830 Effective search space used: 292830 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory