Align palmitoyl-CoA hydrolase (EC 3.1.2.2) (characterized)
to candidate 6935785 Sama_0003 carboxylesterase (RefSeq)
Query= BRENDA::P33018 (278 letters) >FitnessBrowser__SB2B:6935785 Length = 281 Score = 343 bits (880), Expect = 2e-99 Identities = 163/280 (58%), Positives = 208/280 (74%), Gaps = 4/280 (1%) Query: 1 MEMLEEHRCFEGWQQRWRHDSSTLNCPMTFSIFLPPPRDHTPPPVLYWLSGLTCNDENFT 60 +E++ +R F+GW +++ H SS+L+C M F+IFLPP + PVLYWLSGLTC+DENF Sbjct: 3 LELVSANRSFDGWHKQYSHQSSSLDCKMRFAIFLPPQAETQSVPVLYWLSGLTCSDENFM 62 Query: 61 TKAGAQRVAAELGIVLVMPDTSPRGEKVAND-DG-YDLGQGAGFYLNATQPPWATHYRMY 118 KAGAQR+AA LG+ +V DTSPRGE VA+D DG +D G GAGFYLNAT+ PW HYRMY Sbjct: 63 QKAGAQRLAATLGLAIVAMDTSPRGEGVADDPDGAWDFGLGAGFYLNATEAPWNKHYRMY 122 Query: 119 DYLRDELPALVQSQFNVSDRCAISGHSMGGHGALIMALKNPGKYTSVSAFAPIVNPCSVP 178 DY+ ELP L+++ F VS + +I+GHSMGGHGAL +ALKNPG+Y SVSAF+PI NP P Sbjct: 123 DYVVKELPKLIETNFPVSSKRSIAGHSMGGHGALTIALKNPGRYASVSAFSPICNPSQSP 182 Query: 179 WGIKAFSSYLGEDKNAWLEWDSCALMYASNAQDAIPTLIDQGDNDQFLADQLQPAVLAEA 238 WG KAF +YLG+D+ +W E+DSC L+ + IP L+DQGD D FL +L P L A Sbjct: 183 WGQKAFGNYLGKDRESWREYDSCELI--GRGAEPIPMLVDQGDADSFLEAELMPQRLQHA 240 Query: 239 ARQKAWPMTLRIQPGYDHSYYFIASFIEDHLRFHAQYLLK 278 A +P+ LR+QPGYDHSYYFIASFI++HL FH +L + Sbjct: 241 ADNADFPLNLRMQPGYDHSYYFIASFIDEHLEFHHHWLTR 280 Lambda K H 0.320 0.136 0.441 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 292 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 278 Length of database: 281 Length adjustment: 26 Effective length of query: 252 Effective length of database: 255 Effective search space: 64260 Effective search space used: 64260 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory