Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate 6935814 Sama_0032 multifunctional fatty acid oxidation complex subunit alpha (RefSeq)
Query= BRENDA::A4YI89 (259 letters) >FitnessBrowser__SB2B:6935814 Length = 716 Score = 115 bits (289), Expect = 2e-30 Identities = 71/213 (33%), Positives = 113/213 (53%), Gaps = 16/213 (7%) Query: 17 ITLNRPDKLNALNAKLLEELDRAVSQAESDPEIRVIIITGKGKAFCAGADITQFNQLTPA 76 + N P +N + + L L+ A+ + D + + ++T F GADIT+F L Sbjct: 20 LCFNAPGSVNKFDRETLASLNAALDVLK-DSDAKAAVLTSGKDTFIVGADITEFLALFAE 78 Query: 77 EAWKFSK---KGREIMDKIEALSKPTIAMINGYALGGGLELALACDIRIAAEEAQLGLPE 133 E K + + + +K+E L PT++ I G+ALGGG E LA D R+A A++GLPE Sbjct: 79 EDAKLMEWIAQANVVFNKLEDLPFPTVSAIKGFALGGGCEAILATDFRVADTSAKIGLPE 138 Query: 134 INLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVVPLANLEQETRK 193 LG+ PG+GGT RL R+IG ALE + TG +DA K G ++ VV NLE + Sbjct: 139 TKLGLIPGFGGTVRLPRLIGADNALEWITTGKDQRPEDALKVGAIDAVVAPENLEAAAIQ 198 Query: 194 L------------AEKIAKKSPISLALIKEVVN 214 + A + K++P++L ++ +++ Sbjct: 199 MLNDALAGKLDWQARRARKQAPLTLPKLEAMMS 231 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 383 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 716 Length adjustment: 32 Effective length of query: 227 Effective length of database: 684 Effective search space: 155268 Effective search space used: 155268 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory