Align 2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial; AKB ligase; Aminoacetone synthase; Glycine acetyltransferase; EC 2.3.1.29 (characterized)
to candidate 6937269 Sama_1439 8-amino-7-oxononanoate synthase (RefSeq)
Query= SwissProt::Q0P5L8 (419 letters) >FitnessBrowser__SB2B:6937269 Length = 385 Score = 157 bits (397), Expect = 5e-43 Identities = 114/386 (29%), Positives = 176/386 (45%), Gaps = 22/386 (5%) Query: 31 LEEELESIRGAGTWKSERVITSRQGPHIHVDGAPGGIINFCANNYLGLSSHPEVIQAGLR 90 L E AG W+ + R P +++F AN+YLGL+ + +A Sbjct: 8 LAEARVKAESAGLWRQRQ----RHSP---------ALMDFSANDYLGLARDERLAEALAE 54 Query: 91 TLKEFGAGLSSVRFICGTQSIHKDLEAKIARFHQREDAILYPSCFDANTGLFEALLTSED 150 + +G G + + G H +LEA + E A+L+ S F AN L AL S D Sbjct: 55 GARRYGVGSGASPLVSGYSEAHAELEAALCAATGHEAALLFCSGFAANLALCHALFDSTD 114 Query: 151 AVLSDELNHASIIDGIRLCKAHKYRYRHLDMADLEAKLQEAQKHRLRLVATDGAFSMDGD 210 +++D+L HAS+IDGI A+ RY H D++ ++ L T+ FSMDGD Sbjct: 115 TLVADKLIHASMIDGILGSGANLKRYPHCDLSGAARLIERFPGTAL---LTESIFSMDGD 171 Query: 211 IAPLQEICRLASQYGALVFVDESHATGFLGATGRGTDELLGVMDQVTIINSTLGKALGGA 270 +APL + L + +L VD++H G +G G L GV + ++ T GKAL G Sbjct: 172 LAPLLPLSNLCESHNSLFIVDDAHGFGVIGEQAMGASRLDGVNISLQLV--TFGKAL-GC 228 Query: 271 SGGYTTGPGALVSLLRQRARPYLFSNSLPPAAVGCASKALDLLMESNAIVQSMAAKTLRF 330 G G AL+ L AR Y++S +L PA A +L L+ + ++A F Sbjct: 229 QGAAVLGSQALIESLVASARHYIYSTALSPAQAHAARVSLSLVQQGEKSA-TLAVNIRHF 287 Query: 331 RSQMEAAGFTISGANHPICPVMLGDARLALNIADDMLKRGIFVIGFSYPVVPKGKARIRV 390 + + G + + PI + + + L AD + RG V P VP R+R+ Sbjct: 288 LNCAKEVGLALLPSQSPIQLMPVPTVQACLMAADTLKARGFLVGAIRPPTVP--APRLRI 345 Query: 391 QISAVHSEEDIDRCVEAFVEVGRLHG 416 +SA S I+ V A ++ + G Sbjct: 346 TLSAAQSMNSIEALVNALADIEKGFG 371 Lambda K H 0.321 0.136 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 419 Length of database: 385 Length adjustment: 31 Effective length of query: 388 Effective length of database: 354 Effective search space: 137352 Effective search space used: 137352 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory