GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pccA1 in Shewanella amazonensis SB2B

Align acyl CoA carboxylase biotin carboxylase subunit (EC 2.1.3.15; EC 6.4.1.3; EC 6.3.4.14) (characterized)
to candidate 6936392 Sama_0580 acetyl-CoA carboxylase multifunctional enzyme accADC, carboxyl transferase subunit alpha/carboxyl transferase subunit beta/biotin carboxylase (RefSeq)

Query= metacyc::MONOMER-13597
         (509 letters)



>lcl|FitnessBrowser__SB2B:6936392 Sama_0580 acetyl-CoA carboxylase
            multifunctional enzyme accADC, carboxyl transferase
            subunit alpha/carboxyl transferase subunit beta/biotin
            carboxylase (RefSeq)
          Length = 1517

 Score =  287 bits (734), Expect = 2e-81
 Identities = 167/455 (36%), Positives = 251/455 (55%), Gaps = 13/455 (2%)

Query: 1    MPPFSRVLVANRGEIATRVLKAIKEMGMTAIAVYSEADKYAVHT---KYADEAYYIGKAP 57
            M P  +VLV  RG  A ++++   +  +  + V S+ D  AV     K  D+   +G   
Sbjct: 937  MKPIDKVLVHARGCTAVKLIRKAHDNNINVVLVASDPDMTAVPADMLKENDKLVCLGGNT 996

Query: 58   ALDSYLNIEHIIDAAEKAHVDAIHPGYGFLSENAEFAEAVEKAGITFIGPSSEVMRKIKD 117
            + +SYLN   ++  AE  +VDA+HPG GFLSE+ +FA      G+ F+GPS   M  + +
Sbjct: 997  SDESYLNAYSVLKVAEYENVDALHPGIGFLSESPQFAALCVNNGVNFVGPSVHSMTTMGN 1056

Query: 118  KLDGKRLANMAGVPTAPGSDGPVTSIDEALKLAEKIGYPIMVKAASGGGGVGITRVDNQD 177
            K +  + +    VP  PGS G +++ ++A+ +A +IGYP+++KA  GGGG GI  V   +
Sbjct: 1057 KSNAIKTSQAQNVPVVPGSHGILSNAEQAVNVASEIGYPVLLKAVQGGGGKGIQVVKRPE 1116

Query: 178  QLMDVWERNKRLAYQAFGKADLFIEKYAVNPRHIEFQLIGDKYGNYVVAWERECTIQRRN 237
             ++ ++ +    A  AFG  DL++EKY  + RHIE QL+ DK+GN  V   R+C++QR N
Sbjct: 1117 DMIPLFMKTSTEAAAAFGNGDLYLEKYVTSLRHIEVQLLRDKFGNAKVLGLRDCSVQRNN 1176

Query: 238  QKLIEEAPSPALKMEERESMFEPIIKFGKLINYFTLGTFETAFSDVSRDFYFLELNKRLQ 297
            QK+IEE+ S  L  E ++ +       G  ++Y   GT E  ++  + + YF+E+N RLQ
Sbjct: 1177 QKVIEESGSTMLPPELKQQVMAYTKSLGDAVDYMGAGTVEFIYNLDANEVYFMEMNTRLQ 1236

Query: 298  VEHPTTELIFRIDLVKLQIKLAAGEHLPFSQEDLNKRVRGTAIEYRINAEDALNNFTG-- 355
            VEHP TE    ID+V  Q  +AAG     S EDL  +  G A+E R+ AE A  +  G  
Sbjct: 1237 VEHPVTEATSGIDIVSAQFDIAAGR----SIEDLEPQEIGYAMEVRVTAEKAALDSNGVL 1292

Query: 356  ----SSGFVTYYREPTGPGVRVDSGIESGSYVPPYYDSLVSKLIVYGESREYAIQAGIRA 411
                + G +T    P    V + S    G  V PYYDSL++++I+ GESRE  +      
Sbjct: 1293 QLVPNPGKITECVMPERDDVEIISIAAEGKEVSPYYDSLIAQIIIRGESREDVVTKMYDY 1352

Query: 412  LADYKIGGIKTTIELYKWIMQDPDFQEGKFSTSYI 446
            L    I GI T I L K I++D  F EG + T+Y+
Sbjct: 1353 LDSVVIKGIATNIPLLKRILKDATFNEGVYDTNYL 1387


Lambda     K      H
   0.317    0.135    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1472
Number of extensions: 56
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 509
Length of database: 1517
Length adjustment: 42
Effective length of query: 467
Effective length of database: 1475
Effective search space:   688825
Effective search space used:   688825
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 56 (26.2 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory