Align Broadly selective nucleoside:Na+ cotransporter, hfCNT (transports uridine, thymidine, inosine, 3'-azido-3'deoxythymidine, 2'3'dideoxycytidine, and 2'3'dideoxyinosine) (Na+/uridine = 2) (characterized)
to candidate 6936789 Sama_0971 nucleoside transporter (RefSeq)
Query= TCDB::Q9UA35 (683 letters) >FitnessBrowser__SB2B:6936789 Length = 419 Score = 297 bits (760), Expect = 8e-85 Identities = 158/409 (38%), Positives = 250/409 (61%), Gaps = 5/409 (1%) Query: 201 GLILYILLVFIFSKHPTKVRWRIVIWGLLLQFIFGLIILRTKPGLDAFNWLGIQVQTFLK 260 G+ + + + F+ S + + R V L +Q FG +L G D + V + Sbjct: 9 GVAVLLGIGFLLSNNKKAISVRAVGGALAIQAAFGGFVLYVPWGKDILKTVSDGVSAVIG 68 Query: 261 YTDAGSRFLFGDDFQ---DHFFAFAVLPIVIFFSTVMSMMYYLGLMQWLILKVGWLMQIT 317 Y G FLFGD Q FA VLP++IFFS++++++YYLG+MQW+I +G +Q Sbjct: 69 YGQNGINFLFGDLAQFKVGFIFAINVLPVIIFFSSLIAVLYYLGIMQWVIRIIGGGLQKA 128 Query: 318 MGTSPMESMVSAGNIFVGQTESPLLIRPYLADLTISEMHSVMSSGFATIAGSVLGAYISL 377 +GTS ESM + NIFVGQTE+PL++RP++ +T SE+ ++M G A+IAGSVL Y S+ Sbjct: 129 LGTSRTESMSATANIFVGQTEAPLVVRPFIPTMTQSELFAIMVGGLASIAGSVLAGYASM 188 Query: 378 GIPAAHLLTASVMSAPAALAISKTFWPETKKSKNSTQTSIKLEKGQENNLVEAASQGASA 437 G+ +L+ AS M+AP L ++K PET+ +KN + + + N+++AA+ GAS+ Sbjct: 189 GVKIEYLVAASFMAAPGGLLMAKLMHPETENTKNE-MDELPEDPDKPANVLDAAAAGASS 247 Query: 438 AVPLVANIAANLIAFLAVLAFINATLSWLGSMFNYPQFSFEIICSYVLMPFAFMMGVNYD 497 + L N+ A LIAF+ ++A IN + +G F + E+I Y+ MP AF++GV ++ Sbjct: 248 GMHLALNVGAMLIAFVGLIAMINGIIGGVGGWFGVEGLTLELILGYIFMPLAFLIGVPWN 307 Query: 498 DSFLVAELLGMKTFFNEFVAYQRLSEYIHNRESGGPLFVDGVRQYMSVRSEAIATYALCG 557 ++ + +G K NEFVAY + Y+ + GG + V MS R++AI ++ALCG Sbjct: 308 EALVAGSFIGQKIVVNEFVAYLNFAPYLKDIADGG-IVVAETGAAMSDRTKAIVSFALCG 366 Query: 558 FANFGSLGIMIGGLSSLAPHRKSDIASCGIRALIAGTIACFSTACIAGV 606 FAN S+ I++GGL ++AP+R+ D+A GIRA+IAG++A +A +AG+ Sbjct: 367 FANLSSIAILLGGLGAMAPNRRHDLAKLGIRAVIAGSLANLMSATLAGL 415 Lambda K H 0.325 0.139 0.424 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 620 Number of extensions: 21 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 683 Length of database: 419 Length adjustment: 35 Effective length of query: 648 Effective length of database: 384 Effective search space: 248832 Effective search space used: 248832 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory