GapMind for catabolism of small carbon sources

 

Aligments for a candidate for deoB in Shewanella amazonensis SB2B

Align Probable phosphoribomutase; PRM; Phosphoglucomutase 3 homolog; PGM 3 homolog; EC 5.4.2.7 (characterized)
to candidate 6937015 Sama_1189 phosphoglucomutase/phosphomannomutase family protein (RefSeq)

Query= SwissProt::O74478
         (587 letters)



>lcl|FitnessBrowser__SB2B:6937015 Sama_1189
           phosphoglucomutase/phosphomannomutase family protein
           (RefSeq)
          Length = 585

 Score =  315 bits (807), Expect = 3e-90
 Identities = 207/565 (36%), Positives = 283/565 (50%), Gaps = 32/565 (5%)

Query: 1   MDPILQELVDEWFKLDQDETTRNEVSQLIKAEDYATLKQIMHPRIGFGTSGLRAEIGAGF 60
           MD  L   V  W   D D  +R  +  L+ A D   L+     R+ FGT+G+R  +G G 
Sbjct: 1   MDTQLAFKVKHWLARDPDAKSRAALEALVAAGDDRALEAAFDGRLAFGTAGIRGIVGPGP 60

Query: 61  ARMNCLTVIQASQGFAEYLLQTVPSAAKLGVVIGHDHRHKSNTFARLTAAVFLQKGFKTY 120
             MN L V + S G   YL   +  A + G+VIG D RH S  FA   A V    GFK  
Sbjct: 61  MGMNRLLVRETSAGLGAYLEAQIKDAKRRGLVIGFDGRHDSRVFAHDAACVLSAMGFKVR 120

Query: 121 FFDHLVHTPLVPFAVKTLGTAAGVMITASHNPAAYNGYKVYWGNGCAIIPPHDKGIAACI 180
              H+  TPLV F VK    AAG+++TASHNP  YNGYKVYW NG  IIPPHD GIAACI
Sbjct: 121 LTSHVAPTPLVAFGVKHFEAAAGIVVTASHNPPKYNGYKVYWENGAQIIPPHDAGIAACI 180

Query: 181 EK--NL-TPITWDKNLVENHKLA--DRDFAVGLLKNYWSQLHE--FHSENNFSLEMKSLK 233
           ++  NL  P   +   V+  +L+    DF     +   + LH    H          SL 
Sbjct: 181 DRAANLELPWMPEPEAVKQGRLSFLQDDFFERYRR---AILHSPLLHPAGESQAGRASLG 237

Query: 234 FVYTPIHGVGLPFVTSALHLFGEQGDMISVPLQDSPNPDFPTVKFPNPEEEGALDLAYEQ 293
             YT +HGVG P     L   G    + SV  Q  P+ +FPTV FPNPEE GA+D+   +
Sbjct: 238 IAYTAMHGVGAPMAERVLRDAG-FSQVYSVAAQREPDGNFPTVNFPNPEEPGAMDMVIAE 296

Query: 294 ADANGISYVLATDPDADRFAF-AEKINGAWRRFTGDEVGCILAYFIFQEYKNVGKPIDDF 352
           A   G     A DPDADRFA  A + +G +R  +GD+ G +L  ++   ++  G P+   
Sbjct: 297 AGDKGALLACANDPDADRFALAARQSDGGYRMLSGDQTGALLCDYLLSHWQGAGVPL--- 353

Query: 353 YVLSTTVSSAMVKSMAKVEGFHHVETLTGFKWLGNKALELEKQGKFIGLAYEEALGYMVG 412
            V +T VSSA++ ++A   G H   TLTGFKWL N A +LE   +    AYEEALGY VG
Sbjct: 354 -VGNTIVSSALLHAIAAHYGAHSYTTLTGFKWLMNTAQQLETPQQPFLFAYEEALGYTVG 412

Query: 413 SIVRDKDGVNALITFLHLLKRLQLQNLSITEVFEQMSKKYGYYTT-QNSYFLSRDTPKLR 471
           ++V DKDG++A + F +L   L  +   +    E++ +++G Y   Q S  L   TP + 
Sbjct: 413 NLVWDKDGISAQLCFANLAAELLAEGKDVWAALERLYRRHGLYVNRQVSIALGEGTPDIG 472

Query: 472 ALVDALRHYDTKSGYPATLGSKKITNVRDLTTGYDSSSTDGKATLPVSKSSDNVTFELEN 531
           A +        +   P  +  + +    DL         DG+       +SD + + L  
Sbjct: 473 AWL--------RDNPPTEIDKRPVVAREDLKR-LRKVYADGREEEIALPASDVLIYHLGA 523

Query: 532 GEVI------MTIRTSGTEPKLKFY 550
            +        + +R SGTEPK+K Y
Sbjct: 524 SDATPGSTARVIVRPSGTEPKIKCY 548


Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 805
Number of extensions: 36
Number of successful extensions: 6
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 587
Length of database: 585
Length adjustment: 37
Effective length of query: 550
Effective length of database: 548
Effective search space:   301400
Effective search space used:   301400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory