Align Deoxyribose-phosphate aldolase; DERA; 2-deoxy-D-ribose 5-phosphate aldolase; Phosphodeoxyriboaldolase; Deoxyriboaldolase; EC 4.1.2.4 (characterized)
to candidate 6936791 Sama_0973 deoxyribose-phosphate aldolase (RefSeq)
Query= SwissProt::Q8ZJV8 (259 letters) >FitnessBrowser__SB2B:6936791 Length = 257 Score = 335 bits (860), Expect = 4e-97 Identities = 181/260 (69%), Positives = 207/260 (79%), Gaps = 4/260 (1%) Query: 1 MTDLKASSLRALKLMDLTTLNDDDTNEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTL 60 M+DLK ++ RA++LMDLTTLNDDDT EKVI LC +A TP G+TAAICIYPRFIPIARKTL Sbjct: 1 MSDLKKAAQRAIELMDLTTLNDDDTAEKVIELCKKAVTPAGHTAAICIYPRFIPIARKTL 60 Query: 61 KEQGTPDIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALIAGNEQVGFD 120 E DI+IATVTNFPHGNDDI IA+ ETRAA+AYGADEVDVVFPYRAL+ G+E VGF+ Sbjct: 61 IELDAEDIQIATVTNFPHGNDDIAIAVLETRAAVAYGADEVDVVFPYRALMEGDETVGFE 120 Query: 121 LVKACKDACAAANVLLKVIIETGELKEEALIRKASEISIKAGADFIKTSTGKVPVNATPE 180 LVKACK+AC +VLLKVIIE+GELK+ ALIRKASEISI AGADFIKTSTGKVPVNAT E Sbjct: 121 LVKACKEAC-GDDVLLKVIIESGELKDPALIRKASEISIDAGADFIKTSTGKVPVNATLE 179 Query: 181 SARIMMEVIRDMGVSKTVGFKPAGGVRTAEDAQKFLAIADELFGADWADSRHYRFGASSL 240 +A IM+ VI + ++ VGFKPAGGVR A A +FL A + G DW R +RFGASSL Sbjct: 180 AAEIMLTVIAEK--NRAVGFKPAGGVRDAAAAAEFLGTAARILGEDWVTPRTFRFGASSL 237 Query: 241 LASLLKALGHGDG-KSASSY 259 L+SLL L D K A Y Sbjct: 238 LSSLLHTLELADAPKGAQGY 257 Lambda K H 0.318 0.133 0.375 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 250 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 257 Length adjustment: 24 Effective length of query: 235 Effective length of database: 233 Effective search space: 54755 Effective search space used: 54755 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
Align candidate 6936791 Sama_0973 (deoxyribose-phosphate aldolase (RefSeq))
to HMM TIGR00126 (deoC: deoxyribose-phosphate aldolase (EC 4.1.2.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR00126.hmm # target sequence database: /tmp/gapView.24976.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00126 [M=211] Accession: TIGR00126 Description: deoC: deoxyribose-phosphate aldolase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-76 240.0 3.7 1.1e-75 239.7 3.7 1.0 1 lcl|FitnessBrowser__SB2B:6936791 Sama_0973 deoxyribose-phosphate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__SB2B:6936791 Sama_0973 deoxyribose-phosphate aldolase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 239.7 3.7 1.1e-75 1.1e-75 2 206 .. 11 225 .. 10 229 .. 0.96 Alignments for each domain: == domain 1 score: 239.7 bits; conditional E-value: 1.1e-75 TIGR00126 2 lakliDhtalkadtteedietlcaeAkky..kfaavcvnpsyvslAkelLk...gteveictvvgFPlGasttevkl 73 + +l+D+t+l++d+t e++++lc++A+++ ++aa+c++p+++++A+++L +++i+tv++FP+G++++ +++ lcl|FitnessBrowser__SB2B:6936791 11 AIELMDLTTLNDDDTAEKVIELCKKAVTPagHTAAICIYPRFIPIARKTLIeldAEDIQIATVTNFPHGNDDIAIAV 87 5689*************************999****************98756477********************* PP TIGR00126 74 lEakeaieeGAdEvDvviniaalkdkneevviedikavveaca.kvllKvilEtalLtdeekk.kAseisieagadf 148 lE+++a+++GAdEvDvv++++al++++e v++e +ka++eac+ +vllKvi+E ++L+d +++ kAseisi+agadf lcl|FitnessBrowser__SB2B:6936791 88 LETRAAVAYGADEVDVVFPYRALMEGDETVGFELVKACKEACGdDVLLKVIIESGELKDPALIrKASEISIDAGADF 164 *******************************************99****************988************* PP TIGR00126 149 vKtstgfsakgAtvedvrlmkkvvgd...evgvKasGGvrtaedalalieagaerigasaa 206 +Ktstg++ ++At+e +++m v+++ vg+K++GGvr+a a +++ +a +g ++ lcl|FitnessBrowser__SB2B:6936791 165 IKTSTGKVPVNATLEAAEIMLTVIAEknrAVGFKPAGGVRDAAAAAEFLGTAARILGEDWV 225 ************************998889***************************9985 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (211 nodes) Target sequences: 1 (257 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 9.15 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory