Align Maltose/maltodextrin import ATP-binding protein; EC 3.6.3.19 (characterized, see rationale)
to candidate 6937298 Sama_1468 putative macrolide efflux ABC transporter, ATP-binding protein (RefSeq)
Query= uniprot:A8LLL2 (373 letters) >FitnessBrowser__SB2B:6937298 Length = 230 Score = 117 bits (292), Expect = 4e-31 Identities = 75/209 (35%), Positives = 117/209 (55%), Gaps = 14/209 (6%) Query: 15 DVKVLSNINLDIQQGELIVFVGPSGCGKSTLLRMIAGLEKITGGTLEIDGTVVNDVPP-- 72 +V+ L +++ I+Q E + +GPSG GKSTL+ +I L++ T G ++G+ V + Sbjct: 17 EVQALRGVDIHIRQNEFVAIMGPSGSGKSTLMNIIGCLDRPTSGNYLLNGSAVGGLSDDA 76 Query: 73 ----AQRGIAMVFQSYALYPHMTVRENMSFALKIAKKSQAEIDAAVEAAAEKLQLGQYLD 128 R I VFQS+ L P ++ +N+ L+ ++ + + A+E E++ LGQ LD Sbjct: 77 LSAVRNREIGFVFQSFHLLPRLSALDNVLLPLRFSETPRGDRQHAIELL-ERVGLGQRLD 135 Query: 129 RLPKALSGGQRQRVAIGRSIVRDPKVYLFDEPLSNLDAALRVATRLEIAQLKEAMPES-- 186 P LSGGQRQRVAI R++V P + L DEP LD+ T +EI L + + S Sbjct: 136 HRPNQLSGGQRQRVAIARALVNRPTLLLADEPTGALDS----KTSVEIMALFDELHLSGQ 191 Query: 187 TMVYVTHDQVEAMTLATRIVVLAGGGIAQ 215 T+V VTH++ E A RI+ + G + Q Sbjct: 192 TIVLVTHEE-EVAECAGRIIRMRDGVVQQ 219 Lambda K H 0.316 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 19 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 230 Length adjustment: 26 Effective length of query: 347 Effective length of database: 204 Effective search space: 70788 Effective search space used: 70788 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory