Align Energy-coupling factor transporter ATP-binding protein EcfA1; Short=ECF transporter A component EcfA; EC 7.-.-.- (characterized, see rationale)
to candidate 6937060 Sama_1231 peptide ABC transporter, ATP-binding protein (RefSeq)
Query= uniprot:P40735 (281 letters) >FitnessBrowser__SB2B:6937060 Length = 261 Score = 116 bits (290), Expect = 6e-31 Identities = 74/215 (34%), Positives = 122/215 (56%), Gaps = 10/215 (4%) Query: 24 ALDGVSLQVYEGEWLAIVGHNGSGKSTLARALNGLILPESGDIEVAGIQLTEESVWEVRK 83 AL +S ++ GE LAIVG GSGKSTLAR L G SGDI+ G L ++ + + Sbjct: 29 ALAPISFELGRGETLAIVGEAGSGKSTLARILVGAEQRSSGDIQFEGESLESRNLKQRCR 88 Query: 84 KIGMVFQNPDNQF-----VGTTVRDDVAFGLENNGVPREEMIERVDWAVKQVNM-QDFLD 137 I M+FQ+P+ +G + + + F N G+ E +V +++V + + D Sbjct: 89 LIRMIFQDPNTSLNPRLSIGELLEEPLRF---NTGMSAHERSVQVTETLRKVGLLPEHAD 145 Query: 138 QEPHHLSGGQKQRVAIAGVIAARPDIIILDEATSMLDPIGREEVLETVRHLKEQGMATVI 197 PH +S GQKQRVA+A + P +II DEA + LD R ++L + HL+++ + I Sbjct: 146 FYPHMISEGQKQRVAVARALMLSPKVIIADEALTALDLSVRSQILNLLLHLQKEMGLSYI 205 Query: 198 SITHDLNEAAK-ADRIIVMNGGKKYAEGPPEEIFK 231 ++H+LN +D+I+V++ G+ +GP +++F+ Sbjct: 206 FVSHNLNLVRHVSDKIMVLHKGQLIEKGPVQKVFE 240 Lambda K H 0.316 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 155 Number of extensions: 7 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 281 Length of database: 261 Length adjustment: 25 Effective length of query: 256 Effective length of database: 236 Effective search space: 60416 Effective search space used: 60416 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory