Align Tryptophan-specific transport protein; Tryptophan permease (characterized)
to candidate 6939387 Sama_3479 aromatic amino acid transport protein (RefSeq)
Query= SwissProt::Q02DS7 (417 letters) >FitnessBrowser__SB2B:6939387 Length = 418 Score = 465 bits (1196), Expect = e-135 Identities = 239/413 (57%), Positives = 306/413 (74%), Gaps = 3/413 (0%) Query: 6 AQTPSRRPSLLGGSMIIAGTAVGAGMFSLPIAMSGIWFGWSVAVFLLTWFCMLLSGMMIL 65 A+ P + PSLLGG+MIIAGT VGAGMFSLP+ +G+WFG+S+ + + W CMLLSG+++L Sbjct: 8 ARHPVKTPSLLGGAMIIAGTTVGAGMFSLPVVGAGMWFGYSLLLMVAIWLCMLLSGLLLL 67 Query: 66 EANLNYPVGSSFSTITRDLLGQGWNVVNGLSIAFVLYILTYAYISGGGSIIGYTLSSGLG 125 E NL + G+SF T+TRD LG+ +VNGLSIAFVLYILTYAYISGGGSI+ ++LS G+G Sbjct: 68 ETNLRFEPGASFDTLTRDSLGRFGRIVNGLSIAFVLYILTYAYISGGGSIVNHSLS-GMG 126 Query: 126 VTLPEKLAGLLFALAVALVVWWSTRAVDRITTLMLGGMIITFGLSISGLLGRIQPAILFN 185 ++LP+ +AGL+FA +A +V ST+AVDRITT+MLGGMI+TF L++ LL +QP+ LF Sbjct: 127 ISLPQSVAGLVFAAVLAAIVMISTKAVDRITTIMLGGMIMTFFLAVGNLLIEVQPSNLF- 185 Query: 186 SGEPDAVYWPYLLATLPFCLTSFGYHGNVPSLMKYYGKDPQRISRSLWIGTLIALAIYLL 245 S + +A + P+L A +PF L SFGYHGNVPSL+KYYGK+P I +++ IGT IAL IY+ Sbjct: 186 SPDGEARFAPFLWAAIPFGLASFGYHGNVPSLVKYYGKNPSVIIKAICIGTFIALVIYVC 245 Query: 246 WQASTLGTIPREQFKGIIAGGSNVGTLVEYLHRITASDSLNALLTTFSNLAVASSFLGVT 305 W + +G +PR QF IIA G N+G LV L + A+D L +LT F+NLAVASSFLGVT Sbjct: 246 WLLAAMGNLPRSQFSDIIAQGGNMGVLVSALSEVMANDWLGKMLTLFANLAVASSFLGVT 305 Query: 306 LGLFDYLADLCRFDDSHFGRFKTALLTFVPPTIGGLLFPNGFIYAIGFAGLAAAFWAVIV 365 LGLFDYLADL F D GRFKTA +TF+PPT+ GLLFP+GF+ AIGFA LAA W ++V Sbjct: 306 LGLFDYLADLFGFADDAKGRFKTAAVTFLPPTLLGLLFPDGFLVAIGFAALAATVWTLLV 365 Query: 366 PALMARASRKRFGS-PLFRAWGGTPAIVLVLLFGVANAVAHILASLHWLPEYR 417 P +MA RK+ P FR GG I LV+ FG+ A H+LA LP YR Sbjct: 366 PGVMALKLRKQQPDYPGFRVPGGAGVIYLVISFGILTAACHLLAMAELLPVYR 418 Lambda K H 0.326 0.141 0.445 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 635 Number of extensions: 30 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 418 Length adjustment: 32 Effective length of query: 385 Effective length of database: 386 Effective search space: 148610 Effective search space used: 148610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory