Align ABC transporter ATP-binding protein (characterized, see rationale)
to candidate 6936584 Sama_0772 ABC transporter, ATP-binding protein (RefSeq)
Query= uniprot:A0A165KC78 (242 letters) >FitnessBrowser__SB2B:6936584 Length = 319 Score = 95.9 bits (237), Expect = 9e-25 Identities = 65/224 (29%), Positives = 118/224 (52%), Gaps = 11/224 (4%) Query: 1 MAEKSNKVLLQVKGLKVAY-GGIQAVKGVDFEVREGELVSLIGSNGAGKTTTMKAITGTL 59 M + V L+++GLK Y GG++AVKG+ EV +G+ +L+G NGAGK+TT+ I+ + Sbjct: 1 MTVAATGVALRIEGLKKTYKGGVEAVKGISLEVAKGDFFALLGPNGAGKSTTIGIISSLV 60 Query: 60 SMNDGNIEYLGKSIKGKGAWDLVKEGLVMVPEGRGVFARMTITE-NLQMGAYIRKDKAGI 118 + G +E G I + + K + +VP+ T+ + + Y + Sbjct: 61 QKSSGKVEVFGHDIDRQ--LEAAKLCIGLVPQEFNFNQFETVLQIVVNQAGYYGVPRPEA 118 Query: 119 LADIEKMFTIFPRLRERKDQLAGTMSGGEQQMLAMGRALMSQPKVLLLDEPSMGLSPIMV 178 L EK + L ++++ + +SGG ++ L + RALM +PK+L+LDEP+ G+ + Sbjct: 119 LLRAEKYLSALD-LWDKRNSPSRQLSGGMKRRLMIARALMHEPKLLILDEPTAGVDIELR 177 Query: 179 DKIFEVVRDVYALGVTIVLV------EQNASRALAIADRGYVME 216 ++ + ++ GVTI+L + R + I D+G ++E Sbjct: 178 RSMWSFLTELNRQGVTIILTTHYLEEAEMLCRNIGIIDKGELVE 221 Lambda K H 0.317 0.136 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 163 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 242 Length of database: 319 Length adjustment: 25 Effective length of query: 217 Effective length of database: 294 Effective search space: 63798 Effective search space used: 63798 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory