Align isobutyryl-CoA dehydrogenase (EC 1.3.8.5) (characterized)
to candidate 6937192 Sama_1362 isovaleryl-CoA dehydrogenase (RefSeq)
Query= reanno::pseudo13_GW456_L13:PfGW456L13_2985 (383 letters) >FitnessBrowser__SB2B:6937192 Length = 389 Score = 264 bits (675), Expect = 3e-75 Identities = 137/375 (36%), Positives = 223/375 (59%) Query: 6 LSEEQVMIRDMARDFARGEIAPHAQAWEKAGWIDDGLVAKMGELGLLGMVVPEEWGGTYV 65 L E+ M+RD +FA+GEIAP A+ ++ + L AK G++GLLG+ V EE+GG + Sbjct: 12 LGEDVDMLRDAVYEFAKGEIAPLAEKVDRDNAFPNELWAKFGDMGLLGVTVAEEYGGVNM 71 Query: 66 DYVAYALAVEEISAGDGATGAFMSIHNSVGCGPVLNYGSEEQKQTWLADLASGQVIGCFC 125 Y+A+ +A+EEIS + G H+++ + G+E Q+ +L L SG+ IG Sbjct: 72 GYLAHVVAMEEISRASASIGLSYGAHSNLCVNQIYRNGNEAQRAKYLPKLISGEHIGALA 131 Query: 126 LTEPQAGSEAHNLRTRAELRDGQWVINGAKQFVSNGKRAKLAIVFAVTDPDLGKRGISAF 185 ++EP AGS+ +++ A ++++NG K +++NG A +++A TD D G GI+AF Sbjct: 132 MSEPNAGSDVVSMKLHARKEGDRYILNGNKMWITNGPDAHTYVIYAKTDLDKGPHGITAF 191 Query: 186 LVPTDTAGFIVDRTEHKMGIRASDTCAVTLNNCTIPEANLLGERGKGLAIALSNLEGGRI 245 +V GF + K+G+R S+TC + +C +PE N+LG G+ + +S L+ R+ Sbjct: 192 IVERGFKGFSQAQKLDKLGMRGSNTCELVFEDCEVPEENILGGLNNGVKVLMSGLDYERV 251 Query: 246 GIAAQALGIARAAFEAALAYSRDRVQFGKAINEHQSIANLLADMHMQLNAARLMILHAAR 305 ++ LGI A + + Y +RVQFGK+I E Q + LADM+ +NAA+ + + AR Sbjct: 252 VLSGGPLGIMTACMDIVVPYVHERVQFGKSIGEFQLVQGKLADMYTGMNAAKSYVYNVAR 311 Query: 306 LRTAGKPCLSEASQAKLFASEMAEKVCSSAIQIHGGYGYLEDYPVEKYYRDARITQIYEG 365 G+ +A+ L+A+E+A K+ AIQ+ GG GY+ +Y + RDA++ +I G Sbjct: 312 ACDRGETTRKDAAGVILYAAELATKMALDAIQLLGGNGYVNEYATGRLLRDAKLYEIGAG 371 Query: 366 SSEIQRMVIARELKN 380 +SEI+RM+I REL N Sbjct: 372 TSEIRRMLIGRELFN 386 Lambda K H 0.319 0.134 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 339 Number of extensions: 14 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 389 Length adjustment: 30 Effective length of query: 353 Effective length of database: 359 Effective search space: 126727 Effective search space used: 126727 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory