Align 3-hydroxypropionyl-CoA dehydratase (EC 4.2.1.116) (characterized)
to candidate 6938034 Sama_2167 multifunctional fatty acid oxidation complex subunit alpha (RefSeq)
Query= BRENDA::A4YI89 (259 letters) >FitnessBrowser__SB2B:6938034 Length = 706 Score = 137 bits (346), Expect = 5e-37 Identities = 86/242 (35%), Positives = 143/242 (59%), Gaps = 20/242 (8%) Query: 8 TKKEGNLFWITLNRP-DKLNALNAKLLEELDRAVSQAESDPEIR-VIIITGKGKAFCAGA 65 ++++ + +T++ P + +N L A+ E+ + + ++D I+ +++I+GK +F AGA Sbjct: 8 SRRDDGIALLTMDVPGETMNTLKAQFAPEITAILQEIKADSSIKGLVLISGKADSFVAGA 67 Query: 66 DITQFNQLTPAE-AWKFSKKGREIMDKIEALSKPTIAMINGYALGGGLELALACDIRIAA 124 DI+ + AE A S++G + ++E L+ P +A I+G LGGGLELALAC R+ + Sbjct: 68 DISMLDACETAEDARLLSRQGHHVFAELEGLNIPVVAAIHGACLGGGLELALACHQRVCS 127 Query: 125 EEAQ--LGLPEINLGIYPGYGGTQRLTRVIGKGRALEMMMTGDRIPGKDAEKYGLVNRVV 182 + ++ LG+PE+ LG+ PG GGTQRL R+IG +AL++M+TG ++ K A K GLV+ VV Sbjct: 128 DSSKTMLGVPEVQLGLLPGGGGTQRLPRLIGIAKALDLMLTGKQVRPKQAVKMGLVDDVV 187 Query: 183 PLANLEQETRKLAEKIAKKSPISLALIKEVVNRGLDSPLLSGLALES--VGWGVVFSTED 240 P E I + I +AL + + L PL++ L LE VG ++F Sbjct: 188 P------------ESILLDTAIEMALAGKKTRKPLKQPLVTKL-LEGTPVGRNIMFDQAT 234 Query: 241 KK 242 K+ Sbjct: 235 KQ 236 Lambda K H 0.315 0.135 0.382 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 361 Number of extensions: 14 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 706 Length adjustment: 32 Effective length of query: 227 Effective length of database: 674 Effective search space: 152998 Effective search space used: 152998 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory