Align SDR family oxidoreductase (characterized, see rationale)
to candidate 6936328 Sama_0517 D-beta-hydroxybutyrate dehydrogenase (RefSeq)
Query= uniprot:A0A4P7ABK7 (254 letters) >FitnessBrowser__SB2B:6936328 Length = 266 Score = 135 bits (339), Expect = 1e-36 Identities = 85/265 (32%), Positives = 136/265 (51%), Gaps = 13/265 (4%) Query: 1 MSASTGRLAGKTVLITAAAQGIGRASTELFAREGARVIA-----TDISKTHLEELASIAG 55 MS L GK LIT + GIG A+ ++ A +G +I D ++ + A+ Sbjct: 1 MSGGQRSLEGKVGLITGSTSGIGLATAQVLAEQGCNLILHGLLPEDEGQSMAADFAAQYR 60 Query: 56 VETHL--LDVTDDDAIKALVAK----VGTVDVLFNCAGYVAAGNILECDDKAWDFSFNLN 109 + T D+ ++I +A+ +G++D+L N AG ++ + W+ +N Sbjct: 61 IRTFFSNADLRQPESIHRFMAEGTKALGSIDILINNAGIQHTDSVASFPIEKWNDIIAIN 120 Query: 110 AKAMFHTIRAVLPGMLAKKAGSIVNIASAASSVKGVANRFAYGASKAAVVGLTKSVAADF 169 + FHT++ +P M K+ G I+NIAS V V N+ AY A+K +VGLTK VA + Sbjct: 121 LSSAFHTMQQAVPAMAQKRWGRIINIASVHGLVASV-NKAAYCAAKHGIVGLTKVVAIEC 179 Query: 170 VSQGIRCNAICPGTIESPSLNQRISTQAKETGKSEDEVRAAFV-ARQPMGRIGKAEEVAA 228 QGI NAICPG +++P +N++I A G E R V A+QP+ + ++ Sbjct: 180 AEQGITVNAICPGWVDTPLINKQIEAVANTKGLDYHEARYQLVTAKQPLPEMLDPRQIGE 239 Query: 229 LALYLASDESNFTTGSIHMIDGGWS 253 AL+L D + TG+ +DGGW+ Sbjct: 240 FALFLCGDAARGITGASLAMDGGWT 264 Lambda K H 0.316 0.129 0.359 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 254 Length of database: 266 Length adjustment: 24 Effective length of query: 230 Effective length of database: 242 Effective search space: 55660 Effective search space used: 55660 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory