GapMind for catabolism of small carbon sources

 

Protein SM_b20784 in Sinorhizobium meliloti 1021

Annotation: SM_b20784 branched-chain amino acid ABC transporter ATP-binding protein

Length: 238 amino acids

Source: Smeli in FitnessBrowser

Candidate for 20 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-isoleucine catabolism livF med high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 40% 100% 164.9 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-leucine catabolism livF med high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 40% 100% 164.9 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-phenylalanine catabolism livF med high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 40% 100% 164.9 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-valine catabolism livF med high-affinity branched-chain amino acid ABC transporter, ATP-binding protein LivF (characterized) 40% 100% 164.9 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-alanine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 39% 99% 157.9 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-serine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 39% 99% 157.9 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-threonine catabolism braG lo High-affinity branched-chain amino acid transport ATP-binding protein BraG, component of Branched chain amino acid uptake transporter. Transports alanine (characterized) 39% 99% 157.9 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-isoleucine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 39% 96% 156.8 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-leucine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 39% 96% 156.8 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-proline catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 39% 96% 156.8 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-valine catabolism natE lo NatE, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized) 39% 96% 156.8 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-histidine catabolism natE lo NatE aka LivF aka SLR1881, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized) 38% 97% 146 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
D-alanine catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 35% 99% 144.8 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-proline catabolism AZOBR_RS08250 lo Leucine//isoleucine/valine ABC transporter,ATPase component; EC 3.6.3.- (characterized, see rationale) 35% 99% 144.8 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-arginine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 36% 98% 144.1 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-glutamate catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 36% 98% 144.1 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-histidine catabolism braG lo ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale) 36% 98% 144.1 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-proline catabolism HSERO_RS00900 lo ABC-type branched-chain amino acid transport system, ATPase component protein (characterized, see rationale) 35% 98% 139.4 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-serine catabolism Ac3H11_1692 lo ABC transporter ATP-binding protein (characterized, see rationale) 34% 96% 138.7 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8
L-tyrosine catabolism Ac3H11_1692 lo ABC transporter ATP-binding protein (characterized, see rationale) 34% 96% 138.7 Putative branched-chain amino acid uptake ABC transporter ATP-binding protein, component of The protocatechuate (3,4-dihydroxybenzoate) uptake porter, PcaMNVWX 100% 461.8

Sequence Analysis Tools

View SM_b20784 at FitnessBrowser

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Predict protein localization: PSORTb (Gram negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the SEED with FIGfam search

Fitness BLAST: loading...

Sequence

MPAAPLEVDNLSAGYGPTRVLEGISFSVPAGARLAVLGRNGMGKTTLLATLAGQTRRYEG
RIRIGDANVTALPSASRALKGLGFVPQARCVFPSLTVEENLFVGLKGRPKTALSEAYEMF
PRLYERRRNLGSQLSGGEQQMLSTARSILGRPSVLLLDEPLEGLAPVICEELMKAFAELA
KTGGMTILLVEQRIQSALDFADRVIILERGRLAWSGTPEALAKEHATVERLLGVGGLH

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory