GapMind for catabolism of small carbon sources

 

Protein SMc03893 in Sinorhizobium meliloti 1021

Annotation: FitnessBrowser__Smeli:SMc03893

Length: 226 amino acids

Source: Smeli in FitnessBrowser

Candidate for 12 steps in catabolism of small carbon sources

Pathway Step Score Similar to Id. Cov. Bits Other hit Other id. Other bits
L-histidine catabolism Ac3H11_2554 med ABC transporter for L-Histidine, permease component 1 (characterized) 41% 97% 166.8 L-cystine transport system permease protein TcyB 54% 222.2
D-glucosamine (chitosamine) catabolism AO353_21715 lo ABC transporter for D-glucosamine, permease component 1 (characterized) 40% 91% 136.7 L-cystine transport system permease protein TcyB 54% 222.2
D-glucosamine (chitosamine) catabolism AO353_21720 lo ABC transporter for D-glucosamine, permease component 2 (characterized) 34% 97% 136.7 L-cystine transport system permease protein TcyB 54% 222.2
L-arginine catabolism artM lo L-Arginine ABC transporter, permease component 1 (characterized) 36% 97% 128.6 L-cystine transport system permease protein TcyB 54% 222.2
L-lysine catabolism hisM lo Amino acid ABC transporter, membrane protein (characterized, see rationale) 36% 89% 126.7 L-cystine transport system permease protein TcyB 54% 222.2
L-histidine catabolism hisM lo Amino acid (Lysine/arginine/ornithine/histidine/octopine) ABC transporter membrane protein, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized) 35% 97% 126.3 L-cystine transport system permease protein TcyB 54% 222.2
L-asparagine catabolism peb1B lo PEP1B, component of Uptake system for glutamate and aspartate (characterized) 34% 80% 124 L-cystine transport system permease protein TcyB 54% 222.2
L-aspartate catabolism peb1B lo PEP1B, component of Uptake system for glutamate and aspartate (characterized) 34% 80% 124 L-cystine transport system permease protein TcyB 54% 222.2
L-glutamate catabolism peb1B lo PEP1B, component of Uptake system for glutamate and aspartate (characterized) 34% 80% 124 L-cystine transport system permease protein TcyB 54% 222.2
L-lysine catabolism hisQ lo Amino acid ABC transporter, membrane protein (characterized, see rationale) 36% 90% 122.5 L-cystine transport system permease protein TcyB 54% 222.2
L-histidine catabolism aapM lo ABC transporter for L-Glutamine, L-Histidine, and other L-amino acids, permease component 2 (characterized) 33% 56% 115.2 L-cystine transport system permease protein TcyB 54% 222.2
D-alanine catabolism Pf6N2E2_5404 lo ABC transporter for D-Alanine, permease component 1 (characterized) 31% 58% 103.6 L-cystine transport system permease protein TcyB 54% 222.2

Sequence Analysis Tools

View SMc03893 at FitnessBrowser

Find papers: PaperBLAST

Find functional residues: SitesBLAST

Search for conserved domains

Find the best match in UniProt

Compare to protein structures

Predict transmenbrane helices: Phobius

Predict protein localization: PSORTb

Find homologs in fast.genomics

Fitness BLAST: loading...

Sequence

MPHWLQLMADSLPALLWAGLIFTIPLTLLSFTLGLALGLVTAVVRLFAPAPFAAVARFYV
WVIRGTPLLVQLFVIFYGLPSMGILLDAFPAALIGFTLNIGAYSSEIIRAVISSVPRGQW
EAAYSIGMSWSQAMRRTILPQAGRVAVPPLSNTFISLVKDTSLAAAITVPELFQTAQRIV
ATSYEPLILYIEAALIYLVMSSVLSALQGKLEQRFARYGGFLEARA

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see:

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory