Align Alpha-ketoglutarate permease of the major facilitator superfamily protein (characterized, see rationale)
to candidate SMa1328 SMa1328 MtbA protein
Query= uniprot:D8J257 (457 letters) >FitnessBrowser__Smeli:SMa1328 Length = 440 Score = 193 bits (491), Expect = 8e-54 Identities = 130/422 (30%), Positives = 214/422 (50%), Gaps = 22/422 (5%) Query: 23 ILGASSGNLVEWFDFYVYSFCAIYFAPAFFPKGDPTSQLLNTAGVFAAGFLMRPIGGWLF 82 I+ AS GN++EW+DFY++ A + FF + P + LL+T +F AGFL+RP+G +LF Sbjct: 13 IVAASVGNIIEWYDFYIFGSLAAVLSVKFFEQSHPVAALLSTIALFTAGFLIRPLGAFLF 72 Query: 83 GRIADKHGRKTSMLISVLMMCGGSLAVAVMPTYATIGAWAPALLLLARLFQGLSVGGEYG 142 G + D+ GRK + LI++ M G+ A+ ++PTY +IG A LL R+ QGL +GGEYG Sbjct: 73 GWMGDRVGRKYTFLITLTGMGLGTGAIGLIPTYESIGLTAAFLLFSLRMIQGLCLGGEYG 132 Query: 143 TSATYMSEVAPNGRRGFFASFQYVTLIGGQLLAVLVLFGMQQWLTKAELMAWGWRVPFVL 202 + TY++E P+ RRG++ + + G ++++ V+ + + AW WRVPF++ Sbjct: 133 GAITYVAEHVPDERRGYYTGWLQTSPTLGIVVSLAVIIAARTYFGSEAFDAWAWRVPFLV 192 Query: 203 GAVGALVAMYLRSSLAETSSAGARKKKDAGTLKGLLQHKRAFLN----VVGFTA----GG 254 + +A+Y+R L ET K K T + AFL+ VG G Sbjct: 193 SFLLVGIAIYIRLQLQETPIFQEIKAKGQMTQN---PWREAFLSSNIKYVGIATIVLIGQ 249 Query: 255 SLMFYTFTTYMQKYLVNTAGMDPKVANGVMTGALFVYMILQPIFGAISDKIGRRNSMLCF 314 +++Y+ + +L + +DP + ++ AL + +FG +SD IGR+ +L Sbjct: 250 GVVWYSGQFWALYFLQQVSKVDPLNSAYIVGAALLLATPSLILFGWLSDIIGRKPVILGG 309 Query: 315 AFFGMVGTFPILHFLKDVSSP-GVAMALAILALTIVSFYTSI----SGLIKAEMFPPEVR 369 + +P+ +L V+ P + +AI + I+ Y + G AE FP +R Sbjct: 310 MLLAALTYYPLYLWLGAVTQPDNINYPIAIFIIFILVCYVGMVYGPVGAFLAEYFPGRIR 369 Query: 370 ALGVGLSYAVGNAIFGGSAEFVA----LSLKSAGIESAFYWYVSALCLVALIISLRMPDP 425 V + Y +GN GG F+ + S G + V A+C V I MP+ Sbjct: 370 YTSVSVPYHIGNGWGGGLVPFITSAAFAATGSIGYALIYPIAVPAVCFVLAI--FLMPET 427 Query: 426 QR 427 +R Sbjct: 428 RR 429 Lambda K H 0.325 0.138 0.418 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 584 Number of extensions: 38 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 457 Length of database: 440 Length adjustment: 33 Effective length of query: 424 Effective length of database: 407 Effective search space: 172568 Effective search space used: 172568 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory