Align 3-oxoadipate CoA-transferase subunit B; 3-oxoadipate:succinyl-CoA transferase subunit B; Beta-ketoadipate:succinyl-CoA transferase subunit B; EC 2.8.3.6 (characterized)
to candidate SM_b20588 SM_b20588 CoA-transferase subunit B protein
Query= SwissProt::Q8VPF2 (260 letters) >FitnessBrowser__Smeli:SM_b20588 Length = 261 Score = 322 bits (826), Expect = 4e-93 Identities = 156/259 (60%), Positives = 190/259 (73%) Query: 1 MSAYSTNEMMTVAAARRLKNGAVCFVGIGLPSKAANLARLTSSPDVVLIYESGPIGAKPT 60 M+ ++ EMMTVAAAR L N VCFVGIG PS A N+ARLT++PD+ LIYESG +G KP Sbjct: 1 MTHFTPTEMMTVAAARALSNDDVCFVGIGAPSAACNVARLTNAPDITLIYESGTVGTKPD 60 Query: 61 VLPLSIGDGELAETADTVVPTGEIFRYWLQGGRIDVGFLGAAQVDRFGNINTTVIGDYNK 120 VLPLSIGDGEL +TA V E+FRYWLQGGRI GFLG AQ+DRF N+NTTV+G Y+ Sbjct: 61 VLPLSIGDGELCDTALFTVSVPEMFRYWLQGGRITTGFLGGAQIDRFANLNTTVVGPYDH 120 Query: 121 PKVRLPGAGGAPEIAGSAKEVLIILKQSHRTFVDKLAFITSVGHGEGGDHRKQLGLPGKG 180 PKVRLPG GGAPEIA + + I + + R FV++L F+TS+GHGEGG+HR++LGL G Sbjct: 121 PKVRLPGGGGAPEIASNCGRIFITMALTKRGFVERLPFVTSMGHGEGGNHRERLGLTTSG 180 Query: 181 PVAIITDLCIMEPEAGSNEFIVTSLHPGVTREQVIENTGWAIRFAEQVKETAAPTEVELE 240 P +ITDLCI+EP+ + E V S+HPGV R+Q+ N GW I+FAE V ET APTE EL Sbjct: 181 PTRVITDLCILEPDPETKELTVVSMHPGVARDQIAGNCGWPIKFAETVIETPAPTETELV 240 Query: 241 ALRALEARTAAAHGQQGGE 259 LR + ART AH G E Sbjct: 241 VLRDINARTKKAHKAAGKE 259 Lambda K H 0.316 0.135 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 298 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 261 Length adjustment: 25 Effective length of query: 235 Effective length of database: 236 Effective search space: 55460 Effective search space used: 55460 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory