GapMind for catabolism of small carbon sources

 

Aligments for a candidate for hcrA in Sinorhizobium meliloti 1021

Align 4-hydroxybenzoyl-CoA reductase subunit alpha; 4-HBCR subunit alpha; EC 1.3.7.9 (characterized)
to candidate SMa2037 SMa2037 Oxidoreductase

Query= SwissProt::O33819
         (769 letters)



>lcl|FitnessBrowser__Smeli:SMa2037 SMa2037 Oxidoreductase
          Length = 750

 Score =  325 bits (834), Expect = 4e-93
 Identities = 259/777 (33%), Positives = 371/777 (47%), Gaps = 62/777 (7%)

Query: 10  TVGVRTPLVDGVEKVTGKAKYTADIAAPDALVGRILRSPHAHARILAIDTSAAEALEGVI 69
           +VG R    DGV+KVTG+A+Y AD   P  LVGRILRSPHAHA I  IDT  A  L GV 
Sbjct: 14  SVGTRPIRPDGVDKVTGRARYGADFNMPGQLVGRILRSPHAHAIIRKIDTLKAAQLPGVK 73

Query: 70  AVCTGAETP----VPFGVLPIAENEYPLARDKVRYRGDPVAAVAAIDEVTAEKALALIKV 125
           AV T A+ P        +  I +N   +AR K  Y G  VAAVAAID  TA++AL LI+V
Sbjct: 74  AVLTAADLPDLTDGDAAMYDILDN--CMARKKALYDGHAVAAVAAIDARTAKQALKLIEV 131

Query: 126 DYEVLPAYMTPKAAMKAGAIALHD-----------DKPNNILREVHAEFGDVAAAFAEAD 174
           +YE+LP       A    A  ++D           D+P+N+        GDV A  A AD
Sbjct: 132 EYELLPHVTDVDQAFAPDAPLINDTIFTTGVDPKPDRPSNVSMRSQFGHGDVDAGMARAD 191

Query: 175 LIREKTYTFAEVNHVHMELNATLAEY--DPVRDMLTLNTTTQVPYYVHLKVAACLQMDSA 232
            + E+T+   + +  ++E +A +A    D   D   L   TQ  +      A  L MD++
Sbjct: 192 FVVERTFKTEQTHQGYIEPHACVASVSSDGTAD---LWVCTQGHFVYRQHCAQLLGMDAS 248

Query: 233 RIRVIKPFLGGGFGARTEGLHFEIIAGLLARKAKGTVRLLQTREETFIAHRGRPWTEVKM 292
           ++RV    +GGGFG +T  +  E +A  L+RKA   V+L+ TR+E F A      T + +
Sbjct: 249 KLRVTSSEIGGGFGGKTH-VWAEPVALALSRKAGRPVKLVMTRDEVFRASGPTSATSIDV 307

Query: 293 KIGLKKDGKIAALALEATQAGGAYAGYGIITILYTGAL-MHGLYHIPAIKHDAWRVYTNT 351
           KIG  KDG I A       + G YAG         GA+     Y +  ++   + V  N 
Sbjct: 308 KIGALKDGTIIAADATLRYSCGPYAG----AWAEVGAMTAFACYKLENVRTVGYEVLVNR 363

Query: 352 PPCGAMRGHGTVDTRAAFEALLTEMGEELGIDSLKIRQINMLPQIPYVTMYAQRVMSYGV 411
           P   A R         A E+ + E+ +++G++ +  R I    Q      Y       G+
Sbjct: 364 PKTAAYRAPSAPMAAFAVESAIDELAKKVGMNPIDFR-IRNAAQEGTKASYGPVYGPIGI 422

Query: 412 PECLEKVKAASGWEERKGKLPKGRGLGIALSHFVSGTSTPKHWTGEPHATVNLKLDFDGG 471
              LE VK        K  L + +G G+A   +        ++ G+     +L +  DG 
Sbjct: 423 GPTLEAVK---NHPHMKAPLGRNQGRGMACGFWF-------NFGGQ--TCTDLNIGMDGT 470

Query: 472 ITLLTGAADIGQGSNTMASQVAAEVLGVRLSRIRVISADSALTPKDNGSYSSRVTFMVGN 531
           ++L  G  D+G GS    S VAAE LG+  S++R + AD++    ++ +  SR TF    
Sbjct: 471 VSLAVGTVDVG-GSRASLSLVAAEELGIDYSQVRTVIADTSSLGYNDMTDGSRGTFSSSM 529

Query: 532 ASISAAEELKGVLVKAAAKKLDAREEDIEVIDEMFMVSGSQD---PGLSFQEVVKAAMVD 588
           A+ISAA     +L + AA+  D   ED+       +  G      P LS +E+  A+   
Sbjct: 530 ATISAARNAIKILRERAAQMWDIPVEDVTWEKGHAVAKGETHGNLPKLSLKEIAAASGTT 589

Query: 589 SGTITVKGTYTCPTEFQGDKKIRGSAIGATMGFCYAAQVVEASVDEITGKVTAHKVWVAV 648
            G I             G  +I     G +    +A  + +  VD  TG     +  V  
Sbjct: 590 GGPIA------------GHSEIVADGAGVS----FATHICDIEVDPETGATKVLRYTVVQ 633

Query: 649 DVGKALNPLAVEGQTQGGVWMGMGQALSEETVYDN-GRMVHGNILDYRVPTIVESPDIEV 707
           D GKA++P  VEGQ QGG   G+G AL+EE +Y N GR+ +   LDYR+P   + P I+ 
Sbjct: 634 DAGKAVHPTYVEGQYQGGAAQGIGWALNEEYIYGNDGRLQNAGFLDYRIPVCSDLPMIDT 693

Query: 708 IIVESMDPNGPFGAKEASEGMLAGFLPAIHEAVYEAVGVRATDFPLSPDRITELLDA 764
            I+E  +PN P+G +   E  +   L A+  AV  AVGVR    P+SP RI   L+A
Sbjct: 694 QILEIPNPNHPYGVRGVGETSIVPPLAAVANAVSNAVGVRMLHIPMSPPRILAALEA 750


Lambda     K      H
   0.317    0.134    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1269
Number of extensions: 64
Number of successful extensions: 10
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 769
Length of database: 750
Length adjustment: 40
Effective length of query: 729
Effective length of database: 710
Effective search space:   517590
Effective search space used:   517590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.8 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory