Align 3-Carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2) (characterized)
to candidate SM_b20575 SM_b20575 3-carboxy-cis,cis-muconate cycloisomerase
Query= BRENDA::Q2HNZ1 (353 letters) >FitnessBrowser__Smeli:SM_b20575 Length = 351 Score = 392 bits (1006), Expect = e-113 Identities = 206/349 (59%), Positives = 247/349 (70%) Query: 1 MSLSPFEHPFLSGLFGDSEIIELFSAKADIDAMIRFETALAQAEAEASIFADDEAEAIVS 60 M+ S F+HP+LSGL GD + FS AD+ AM+ FE ALA+AEA + + A I Sbjct: 1 MTYSAFDHPYLSGLLGDEAVAAEFSVVADVRAMLAFEAALARAEARHGVIPEAAANRIAE 60 Query: 61 GLSEFAADMSALRHGVAKDGVVVPELIRQMRAAVAGQGADKVHFGATSQDVIDTSLMLRL 120 F+ D+ A+R A DGVVVPEL+RQ+R AV + A+ VHFGATSQDV+DTSLMLRL Sbjct: 61 ACRGFSPDVGAMRRATAIDGVVVPELVRQLRRAVGEEAAEHVHFGATSQDVVDTSLMLRL 120 Query: 121 KMAAEIIATRLGHLIDTLGDLASRDGHKPLTGYTRMQAAIGITVADRAAGWIAPLERHLL 180 K AE+ + R+G ++ L G + LT +TRMQ AI ITVADR WI PL H Sbjct: 121 KAIAELFSGRVGDVVTALEACGRHWGERALTAHTRMQPAIAITVADRLRSWIEPLLDHQD 180 Query: 181 RLETFAQNGFALQFGGAAGTLEKLGDNAGAVRADLAKRLGLADRPQWHNQRDGIPEFANL 240 RL+T + FA+QFGGAAGTLEKL A VRA LA+ L L D PQWH+QR I +FA+L Sbjct: 181 RLDTTGTDIFAVQFGGAAGTLEKLKGKADIVRATLAEELALVDCPQWHSQRLPIADFAHL 240 Query: 241 LSLVTGTLGKFGQDIALMAEIGSEIRLSGGGGSSAMPHKQNPVNAETLVTLARFNAVQIS 300 LSLVTG+LGKFGQD+ALMA+ G EI L+GGGGSSAMPHKQNPV AE LVTLARFNA Q+S Sbjct: 241 LSLVTGSLGKFGQDVALMAQAGDEIVLAGGGGSSAMPHKQNPVAAEVLVTLARFNATQVS 300 Query: 301 ALHQSLVQEQERSGAGWMLEWLTLPQMVTATGTSLLVAERLAAQIDRLG 349 A+HQSLV EQERSG+ W LEWL LPQMV AT +L +A LA + RLG Sbjct: 301 AIHQSLVHEQERSGSAWTLEWLILPQMVGATAAALRLAAELAGNVRRLG 349 Lambda K H 0.318 0.133 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 401 Number of extensions: 17 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 351 Length adjustment: 29 Effective length of query: 324 Effective length of database: 322 Effective search space: 104328 Effective search space used: 104328 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate SM_b20575 SM_b20575 (3-carboxy-cis,cis-muconate cycloisomerase)
to HMM TIGR02426 (pcaB: 3-carboxy-cis,cis-muconate cycloisomerase (EC 5.5.1.2))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02426.hmm # target sequence database: /tmp/gapView.17412.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02426 [M=338] Accession: TIGR02426 Description: protocat_pcaB: 3-carboxy-cis,cis-muconate cycloisomerase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-123 395.7 16.9 8.1e-123 395.6 16.9 1.0 1 lcl|FitnessBrowser__Smeli:SM_b20575 SM_b20575 3-carboxy-cis,cis-muco Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SM_b20575 SM_b20575 3-carboxy-cis,cis-muconate cycloisomerase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 395.6 16.9 8.1e-123 8.1e-123 2 336 .. 11 343 .. 10 345 .. 0.99 Alignments for each domain: == domain 1 score: 395.6 bits; conditional E-value: 8.1e-123 TIGR02426 2 ldglfgdseaaelfsdrarlramldvEaalaraqadvGlipaeaaeaiaaaaaelalDlealaeaaaeagnvvi 75 l+gl gd+++a+ fs a++raml++Eaalara+a+ G+ip++aa++ia a++ +++D+ a+++a+a +g+vv+ lcl|FitnessBrowser__Smeli:SM_b20575 11 LSGLLGDEAVAAEFSVVADVRAMLAFEAALARAEARHGVIPEAAANRIAEACRGFSPDVGAMRRATAIDGVVVP 84 68999********************************************************************* PP TIGR02426 76 plvkalrkavaeeaaryvHlGaTSQDviDTalmLqlrdaldllladlerlaeaLaelaarhrdtpltarTllQq 149 +lv++lr+av+eeaa++vH+GaTSQDv+DT+lmL+l++ ++l +++ ++ aL + ++ ++ +lta+T++Q+ lcl|FitnessBrowser__Smeli:SM_b20575 85 ELVRQLRRAVGEEAAEHVHFGATSQDVVDTSLMLRLKAIAELFSGRVGDVVTALEACGRHWGERALTAHTRMQP 158 ************************************************************************** PP TIGR02426 150 AvpttvglkaagwlaavlrardrlealrtealalqfGGAaGtlaalekkglavaealAaelgLeapalpWhtqr 223 A+++tv++++ +w++++l+++drl++ t+++a+qfGGAaGtl++l+ k+ v++ lA+el L + +Wh+qr lcl|FitnessBrowser__Smeli:SM_b20575 159 AIAITVADRLRSWIEPLLDHQDRLDTTGTDIFAVQFGGAAGTLEKLKGKADIVRATLAEELALVD-CPQWHSQR 231 *****************************************************************.9******* PP TIGR02426 224 driaelaaaLalvagalgkiaqDvallaqtevgevleaggGGSSampHKrNPvaaevlaaaarrapglvatLfa 297 +ia++a++L+lv+g+lgk++qDval+aq+ ++vl ggGGSSampHK+NPvaaevl+++ar+++++v+++++ lcl|FitnessBrowser__Smeli:SM_b20575 232 LPIADFAHLLSLVTGSLGKFGQDVALMAQAGDEIVLA-GGGGSSAMPHKQNPVAAEVLVTLARFNATQVSAIHQ 304 **********************************998.99********************************** PP TIGR02426 298 alaqedeRsaggWhaeWetLrelvaltagalrqaaelle 336 +l++e+eRs+++W +eW +L+++v +ta+alr aael+ lcl|FitnessBrowser__Smeli:SM_b20575 305 SLVHEQERSGSAWTLEWLILPQMVGATAAALRLAAELAG 343 *********************************999875 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (338 nodes) Target sequences: 1 (351 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.01 # Mc/sec: 6.70 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory