Align 3-oxoadipate enol-lactonase (EC 3.1.1.24) (characterized)
to candidate SM_b20579 SM_b20579 beta-ketoadipate enol-lactone hydrolase
Query= BRENDA::Q13KT2 (263 letters) >FitnessBrowser__Smeli:SM_b20579 Length = 268 Score = 159 bits (403), Expect = 4e-44 Identities = 93/251 (37%), Positives = 127/251 (50%), Gaps = 2/251 (0%) Query: 1 MPYAAVNGTELHYRIDGERHGNAPWIVLSNSLGTDLSMWAPQVAALSKHFRVLRYDTRGH 60 M + +N +HYR+ G P +V NSLGTD +W V L+ F ++ YD RGH Sbjct: 1 MQFTRINDVTIHYRVVGAVT-EKPALVFINSLGTDFRIWRDVVLRLAGDFAIVLYDKRGH 59 Query: 61 GHSEAPKGPYTIEQLTGDVLGLMDTLKIARANFCGLSMGGLTGVALAARHADRIERVALC 120 G S+ + PY+IE D+ GL+D L + +A CGLS+GGL +L R D + + L Sbjct: 60 GLSDIGQVPYSIEDHATDLAGLLDRLAVKQAIVCGLSVGGLIAQSLYGRRPDLVRALVLS 119 Query: 121 NTAARIGSPEVWVPRAVKARTEGMHALADAVLPRWFTADYMEREPVVLAMIRDVFVHTDK 180 TA +IG+ E W R G+ A+AD VL RWFT + E + R++ V Sbjct: 120 GTAHKIGTVEFWDARITAIEAHGIEAVADGVLERWFTPAFRRPENLAFTGYRNMLVRQPV 179 Query: 181 EGYASNCEAIDAADLRPEAPGIKVPALVISGTHDLAATPAQGRELAQAIAGARY-VELDA 239 GY C AI AD A I VP L + G D + P R A I GAR+ V A Sbjct: 180 PGYVGTCAAIRDADFTEAAGRIAVPVLCVVGDQDGSTPPDLVRSTADLIPGARFEVIRGA 239 Query: 240 SHISNIERADA 250 HI +E+ +A Sbjct: 240 GHIPCVEQPEA 250 Lambda K H 0.320 0.134 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 6 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 268 Length adjustment: 25 Effective length of query: 238 Effective length of database: 243 Effective search space: 57834 Effective search space used: 57834 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate SM_b20579 SM_b20579 (beta-ketoadipate enol-lactone hydrolase)
to HMM TIGR02427 (pcaD: 3-oxoadipate enol-lactonase (EC 3.1.1.24))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.carbon/TIGR02427.hmm # target sequence database: /tmp/gapView.17558.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02427 [M=251] Accession: TIGR02427 Description: protocat_pcaD: 3-oxoadipate enol-lactonase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9e-118 378.2 0.0 1e-117 378.0 0.0 1.0 1 lcl|FitnessBrowser__Smeli:SM_b20579 SM_b20579 beta-ketoadipate enol- Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Smeli:SM_b20579 SM_b20579 beta-ketoadipate enol-lactone hydrolase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 378.0 0.0 1e-117 1e-117 1 251 [] 10 260 .. 10 260 .. 0.99 Alignments for each domain: == domain 1 score: 378.0 bits; conditional E-value: 1e-117 TIGR02427 1 rlhyrlegaeadkpvlvlinSLGtdlrlwdkvlealtkdfrvlryDkrGHGlSdvpegpysiedladdvlallD 74 ++hyr+ ga ++kp+lv+inSLGtd+r+w++v+ +l+ df+++ yDkrGHGlSd++++pysied+a+d+++llD lcl|FitnessBrowser__Smeli:SM_b20579 10 TIHYRVVGAVTEKPALVFINSLGTDFRIWRDVVLRLAGDFAIVLYDKRGHGLSDIGQVPYSIEDHATDLAGLLD 83 59************************************************************************ PP TIGR02427 75 algiekaavcGlSlGGliaqaLaarrpdrvealvlsntaakigtaesWeaRiaavraeGlaaladavlerwFtp 148 +l +++a vcGlS+GGliaq+L+ rrpd+v+alvls ta+kigt e+W+aRi+a++a+G++a+ad+vlerwFtp lcl|FitnessBrowser__Smeli:SM_b20579 84 RLAVKQAIVCGLSVGGLIAQSLYGRRPDLVRALVLSGTAHKIGTVEFWDARITAIEAHGIEAVADGVLERWFTP 157 ************************************************************************** PP TIGR02427 149 afreaepaelelvrnmlveqppegYaatcaAirdadlrerleeiavPtlviaGdeDgstPpelvreiadlvpga 222 afr++e+ +++ +rnmlv+qp+ gY++tcaAirdad++e++++iavP+l+++Gd+DgstPp+lvr++adl+pga lcl|FitnessBrowser__Smeli:SM_b20579 158 AFRRPENLAFTGYRNMLVRQPVPGYVGTCAAIRDADFTEAAGRIAVPVLCVVGDQDGSTPPDLVRSTADLIPGA 231 ************************************************************************** PP TIGR02427 223 rfaeieeaaHlpnleqpeafaallrdflk 251 rf++i++a+H+p++eqpea++++lr+f++ lcl|FitnessBrowser__Smeli:SM_b20579 232 RFEVIRGAGHIPCVEQPEALWSVLRRFFR 260 ***************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (251 nodes) Target sequences: 1 (268 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 6.91 // [ok]
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory