Align subunit of β-ketoadipyl CoA thiolase (EC 2.3.1.174; EC 2.3.1.16) (characterized)
to candidate SMa1450 SMa1450 thiolase
Query= metacyc::MONOMER-3207 (400 letters) >FitnessBrowser__Smeli:SMa1450 Length = 396 Score = 262 bits (670), Expect = 1e-74 Identities = 155/395 (39%), Positives = 229/395 (57%), Gaps = 8/395 (2%) Query: 4 VFICDAIRTPIGRFGGALAGVRADDLAAVPLKALIEPNPAVQWDQVDEVFFGCANQAGED 63 V I RTP+G F G L + A DL A + ++ + D VDEV FGC AG+ Sbjct: 7 VVIVGQARTPLGSFQGELKDLSAADLGAAAIVDALK-RAGLAPDAVDEVMFGCVLTAGQ- 64 Query: 64 NRNVARMALLLAGLPESIPGVTLNRLCASGMDAIGTAFRAIASGEMELAIAGGVESMSRA 123 + AR A L AGLP + T+N++C SGM A A I + + +AGG+ESM+ A Sbjct: 65 GQAPARQAALGAGLPPGVGATTVNKMCGSGMKAAMLAHDLIKAESASIVVAGGMESMTNA 124 Query: 124 PFVMGKAESGYSRNMKLEDTTIGWRFINPLMKSQYGVDSMPETADNVADDYQVSRADQDA 183 P+++ +A GY + F++ L + M A++ A+ YQ +R+ QD Sbjct: 125 PYLLDRARQGYRIG---HQKVLDHMFLDGLEDAYDKGRLMGSFAEDCAEAYQFTRSAQDE 181 Query: 184 FALRSQQKAAAAQAAGFFAEEIVPVRIAHKKGETIVERDEHLRPETTLEALTKLKPVNGP 243 +A+ S +KA A A G FAEEIVP+ IA KGE V DE + + L+ + LKP Sbjct: 182 YAIASLEKAQKASADGSFAEEIVPLSIASGKGERTVNLDEQPQ-KARLDKIPLLKPAFRD 240 Query: 244 DKTVTAGNASGVNDGAAALILASAEAVKKHGLTPRARVLGMASGGVAPRVMGIGPVPAVR 303 T+TA NAS ++DGAAAL+L A K G+ P A + G A+ AP + P+ A++ Sbjct: 241 GGTITAANASSISDGAAALVLMRRSAADKQGIGPLAVICGHATHADAPSLFPTAPIGAIK 300 Query: 304 KLTERLGVAVSDFDVIELNEAFASQGLAVLRELGVADDAPQVNPNGGAIALGHPLGMSGA 363 L R+G + + D+ E+NEAFA +A +RELG+ DA +VN +GGA ALGHP+G SGA Sbjct: 301 ALCRRIGWDIGEVDLFEINEAFAVVPMAAMRELGL--DAEKVNVHGGACALGHPIGASGA 358 Query: 364 RLVLTALHQLEKSGGRKGLATMCVGVGQGLALAIE 398 R+++T ++ L + G R+G+A++C+G G+ A+A+E Sbjct: 359 RVIVTLVNALRRRGLRRGIASVCIGGGEATAVAVE 393 Lambda K H 0.318 0.134 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 23 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 400 Length of database: 396 Length adjustment: 31 Effective length of query: 369 Effective length of database: 365 Effective search space: 134685 Effective search space used: 134685 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory