Align protocatechuate 3,4-dioxygenase (subunit 2/2) (EC 1.13.11.3) (characterized)
to candidate SM_b20576 SM_b20576 protocatechuate 3,4-dioxygenase subunit alpha
Query= BRENDA::A0A193DXA9 (206 letters) >FitnessBrowser__Smeli:SM_b20576 Length = 204 Score = 282 bits (721), Expect = 3e-81 Identities = 143/206 (69%), Positives = 159/206 (77%), Gaps = 2/206 (0%) Query: 1 MVQPLNYFKETASQTAGPYVHIGCTPNFVGIEGVFEKDLGSGPLYNDKARGERISVRGTV 60 MVQ L+ KETASQTAGPYVHIG TP+F GI GV+E DLG+ + NDK G+RI+V G V Sbjct: 1 MVQDLSTLKETASQTAGPYVHIGLTPSFCGIGGVYEGDLGAS-MVNDKTLGQRITVTGRV 59 Query: 61 YDGAGMPLKDALIEIWQADTDGYYNSPSETRGKADPNFIGWGRSPGDMDTGEFVFETIKP 120 DGAGMPL+DAL+EIWQAD G YNSPSE RG ADPNF GWGRSP + G F FET+KP Sbjct: 60 IDGAGMPLRDALLEIWQADAAGLYNSPSELRGTADPNFTGWGRSPTSDEGGVFTFETVKP 119 Query: 121 GSVPFRDGRPMAPHITFWIVARGINIGLQTRMYFPEEQEANAADPVLARIEQKSRIATLV 180 G VPFRDGR MAPHI+ WIVARGINIGL TRMYFP+E ANA DP+LARIE + R TLV Sbjct: 120 GRVPFRDGRLMAPHISIWIVARGINIGLHTRMYFPDEAAANAEDPLLARIEHRHRAETLV 179 Query: 181 AKKEEGNVYRFDIRLQGEGETVFFDI 206 A + N Y FDI LQGE ETVF DI Sbjct: 180 AAGQAPN-YVFDIHLQGEKETVFLDI 204 Lambda K H 0.318 0.139 0.426 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 226 Number of extensions: 5 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 206 Length of database: 204 Length adjustment: 21 Effective length of query: 185 Effective length of database: 183 Effective search space: 33855 Effective search space used: 33855 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory