Align D-lactate transporter, ATP-binding component (characterized)
to candidate SM_b20785 SM_b20785 branched-chain amino acid ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >FitnessBrowser__Smeli:SM_b20785 Length = 254 Score = 156 bits (394), Expect = 4e-43 Identities = 90/250 (36%), Positives = 141/250 (56%), Gaps = 6/250 (2%) Query: 3 ILEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMF 62 I EV+N+ + FGGL +DV+LS+ A+IGPNGAGK+T +N + G L PD G V Sbjct: 4 IFEVRNLKRSFGGLAVTNDVSLSMAPGDRVALIGPNGAGKTTFVNLVTGNLKPDAGEVRI 63 Query: 63 DGKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEM-NAISAVSG 121 G++V + G+ R FQ +F D++ E++ + + A M A+ G Sbjct: 64 GGETVTNVDAIGRVRRGLVRSFQVTRLFQDMTPAEHVALAVLQRDGRAGRMFGNFLAMPG 123 Query: 122 QRDILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMAR 181 ++ +A +L ++ + D H ++ G +R LEI + L+ +PR+LLLDEP AG+ + Sbjct: 124 ---VMAEAGSLLGKLGLRDLAHRPVREIAYGQQRLLEIAVALALKPRVLLLDEPAAGVPQ 180 Query: 182 ADTNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNPK 241 +DT L + D+ + +IEHDM +VF A R+ VLA GT + + P ++ +P+ Sbjct: 181 SDTGRIEQALADLPD--DLAVLMIEHDMDLVFRFAKRVIVLAAGTVIFDGSPADVTKDPR 238 Query: 242 VREAYLGESA 251 VREAYLG A Sbjct: 239 VREAYLGSYA 248 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 254 Length adjustment: 24 Effective length of query: 227 Effective length of database: 230 Effective search space: 52210 Effective search space used: 52210 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory