Align D-lactate transporter, ATP-binding component (characterized)
to candidate SMc02357 SMc02357 high-affinity branched-chain amino acid ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF1248 (251 letters) >FitnessBrowser__Smeli:SMc02357 Length = 244 Score = 167 bits (424), Expect = 1e-46 Identities = 97/248 (39%), Positives = 142/248 (57%), Gaps = 12/248 (4%) Query: 4 LEVKNVGKRFGGLQALSDVNLSVRENTVHAIIGPNGAGKSTLLNCLVGKLIPDTGSVMFD 63 L V +V F GL+AL V+LSV V +IGPNG+GK+TL+N + G++ TG++ Sbjct: 6 LAVNDVSVEFTGLRALDHVSLSVAAGEVVGLIGPNGSGKTTLINAITGQVKLATGTIAAG 65 Query: 64 GKSVLGRAPYEINQMGISRVFQTPEIFGDLSVLENMMIPCFAKRDGAFEMNAISAVSGQR 123 ++ G +P EI G+SR FQ IF ++V+EN+ AK A VS +R Sbjct: 66 DTTLSGLSPREIALAGVSRSFQIVRIFNSMTVMENVEAAALAK-------GASRTVSAER 118 Query: 124 DILEKAEHMLEEMNMADKRHMNAASMSRGDKRRLEIGMCLSQEPRLLLLDEPTAGMARAD 183 A+ +L E+ + K S+S GDKRR+EI L+ EPR LLLDEP AGM A+ Sbjct: 119 -----AKGLLAELGLTAKADELGESLSYGDKRRVEIARALAAEPRFLLLDEPAAGMNDAE 173 Query: 184 TNNTIDLLKQIKSERDITIAIIEHDMHVVFSLADRITVLAQGTPLVEDDPQNIKGNPKVR 243 T + L ++ +R + + II+HDM ++ L R+ VLA G + E D +++ +P V Sbjct: 174 TETLLHTLAELPEKRGLGLLIIDHDMGLIMRLCHRLHVLASGRTIAEGDAAHVRSHPAVI 233 Query: 244 EAYLGESA 251 EAYLG+ A Sbjct: 234 EAYLGKGA 241 Lambda K H 0.318 0.135 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 244 Length adjustment: 24 Effective length of query: 227 Effective length of database: 220 Effective search space: 49940 Effective search space used: 49940 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory