Align L-lactate oxidase (EC 1.1.3.2) (characterized)
to candidate SMa0404 SMa0404 FMN-dependent dehydrogenase
Query= BRENDA::F8WQN2 (384 letters) >FitnessBrowser__Smeli:SMa0404 Length = 381 Score = 232 bits (591), Expect = 2e-65 Identities = 145/374 (38%), Positives = 206/374 (55%), Gaps = 22/374 (5%) Query: 4 LSFLNLEEVEEEAKKVMPKMAFDYYSTGSDTCYTVGENRSCFSRYLLLPRMLRNVSRVDT 63 ++ +N+++ + A++ PK+ FDY GS T+ NRS FSR L +L D Sbjct: 1 MALVNIDDFRDLARRRRPKIFFDYIDGGSFEEETMRANRSDFSRLTLRQNVLVEPQPQDL 60 Query: 64 SHELFGIRSSMPVWVAPMAMHGLAHPGREVATCRAAAAAGVPFTFSTVATSSLQEIQETG 123 + G R +P + P+ GL EV RAA AAG+PF ST + +SL +++ Sbjct: 61 ATAYLGKRHPLPFMLGPVGFLGLYSGKGEVKAVRAAHAAGIPFCLSTFSIASLADLRIVT 120 Query: 124 HDNRIFQLYVIRNREVVRRWVTEAESRGFKALMVTVDAQRLGNREADARNKF-------- 175 FQLYV+ +R + ++ AE G L VTVD G RE D RN F Sbjct: 121 DGPLHFQLYVLEDRSLCEEFLRAAEYAGVDTLFVTVDTAITGIRERDVRNGFRSLTRVTP 180 Query: 176 -------TLPPGLALRNLEYLSSASTVQARDSQDGSGLMKL---FTSEVDDSLTWEFIPW 225 P LA L + S V+ R + G G ++ + +D +L+W+ I W Sbjct: 181 DLFARLALKPRWLAEVVLAGMPSVRAVEHR-PEFGRGALEQAANLSRRIDKTLSWKDIAW 239 Query: 226 LRGVTKLPIIVKGLLSPADAELAVQYGVDGIVVSNHGGRQLDYAPSGLHMLPAVVAAVRG 285 LR +++KG+L+PADA A G DG+VVSNHGGRQLD APS + LP++ A V Sbjct: 240 LRERWAGKLVIKGVLTPADAVRARDLGCDGVVVSNHGGRQLDGAPSTIRALPSIRATV-- 297 Query: 286 CGSSIPVLVDGGVRRGTDVIKALALGASGVLLGRPVLYGLAVGGQAGVERVLQLLRSEIE 345 G+ +++DGG+RRG DVIKA+ALGA GV+LGR YGL+ GQAGV V+ +L EI Sbjct: 298 -GTDFCLMLDGGIRRGADVIKAIALGADGVMLGRAYAYGLSAAGQAGVAEVIAILEREIS 356 Query: 346 LSMALAGCSSVQQI 359 +S+AL G +SV+Q+ Sbjct: 357 ISLALMGIASVEQL 370 Lambda K H 0.320 0.135 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 275 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 384 Length of database: 381 Length adjustment: 30 Effective length of query: 354 Effective length of database: 351 Effective search space: 124254 Effective search space used: 124254 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory