Align putative transporter, required for L-alanine utilization (characterized)
to candidate SMc00330 SMc00330 transmembrane protein
Query= reanno::MR1:202450 (213 letters) >FitnessBrowser__Smeli:SMc00330 Length = 211 Score = 133 bits (335), Expect = 2e-36 Identities = 66/188 (35%), Positives = 112/188 (59%) Query: 14 GILAEAMTGALAAGRKQMDLFGVVIIGCATAIGGGTLRDMLLGNYPLVWVENVHYLIAIA 73 G+ A TGAL+A RKQ+D+ G + + AT IGGGT+RD++LG P+ WV N +++I A Sbjct: 11 GVAIFAATGALSASRKQLDIIGYLFLASATGIGGGTIRDLVLGATPVFWVVNPNFIIVCA 70 Query: 74 FASLLTVAIAPVMRYLSKLFLAIDALGLAVFSIVGAQKTLMLGFSPTIAVVMGLVTGVFG 133 ++ + ++ ++ + +DALGL+ + ++GA K L SP +A+V G +T FG Sbjct: 71 AVAVAVFLTSHLLESRYRMLVWLDALGLSAYCVMGAAKGLAATGSPIVALVTGALTATFG 130 Query: 134 GVIRDILCNQVPLIFKKELYAVISLFTAGLYITLNAYQLEEWINLVICLTLGFSLRMLAL 193 GV+RD+L + ++ + E+Y +L AG ++ + L + + F++R AL Sbjct: 131 GVLRDLLAGEPSVLLRPEIYVSAALIGAGAFVLASLAGLPLVATSALGVITAFAVRGGAL 190 Query: 194 RYHWSMPT 201 RY W++PT Sbjct: 191 RYGWTLPT 198 Lambda K H 0.330 0.143 0.436 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 152 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 213 Length of database: 211 Length adjustment: 21 Effective length of query: 192 Effective length of database: 190 Effective search space: 36480 Effective search space used: 36480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory