Align glycolaldehyde oxidoreductase medium subunit (characterized)
to candidate SM_b20130 SM_b20130 dehydrogenase
Query= metacyc::MONOMER-18072 (282 letters) >FitnessBrowser__Smeli:SM_b20130 Length = 287 Score = 120 bits (300), Expect = 4e-32 Identities = 88/281 (31%), Positives = 137/281 (48%), Gaps = 4/281 (1%) Query: 6 FTYVRVSSSEEATKFLES-HDDARPLAGGQSLIPMLKLRVISPNYIVDLNPITSL-SYVR 63 F Y +S EA+ L DA +AGG L+ +K + S ++V++ I +L + Sbjct: 4 FEYYEPASLAEASDLLRRLGKDASIIAGGTDLLVEMKEELRSVLHLVNIKKIPNLRDFTY 63 Query: 64 SSFNSTKIGALTRYNEILKNDLVRVNVPLLHQAVRVVGDMQVRNLGTIGGSAANADPSAD 123 + GAL EI + V N P L +AV ++G +QVRN TI G+ A PSAD Sbjct: 64 DPAAGLRFGALVTVREIETSPHVIGNYPNLAKAVSLLGSVQVRNRATIVGNICRASPSAD 123 Query: 124 IPTVLTALNAEIILSSASGNRSVNALDFFKGAFATDLRKGEIISEIVL--PNLEGYRTIY 181 L A A + + + R++ DFF G T L G+I++ I L P R Sbjct: 124 TIPPLIADGASLSVYNGGTERTILLEDFFTGPGRTVLSPGDIVTGISLPAPRPTSGRAYI 183 Query: 182 KKVVRRAGDFALVSLALAIKLRQNEIEDIRLAYGGVGERPFRALEVEKSVMGKRLNDELV 241 K R+A + A V +A++I+ + DIR+A G V RA E + G+R++ L+ Sbjct: 184 KHGRRKAMELATVGVAVSIEHVAGQCSDIRIALGAVAPTVIRARRTEDLIRGRRIDAALL 243 Query: 242 EEIVSKVSSQVNPPSDTRGSSWYRREVMKVITRKALKEVSG 282 E + P + R S+ YRR+++ V+TR+A+ G Sbjct: 244 AEAAESAMQEATPIGNVRASAAYRRDMVGVLTRRAIGYAMG 284 Lambda K H 0.317 0.134 0.367 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 178 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 282 Length of database: 287 Length adjustment: 26 Effective length of query: 256 Effective length of database: 261 Effective search space: 66816 Effective search space used: 66816 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory