Align L-arabinose-binding periplasmic protein; ABP (characterized)
to candidate SM_b20508 SM_b20508 sugar ABC transporter substrate-binding protein
Query= SwissProt::P02924 (329 letters) >FitnessBrowser__Smeli:SM_b20508 Length = 327 Score = 305 bits (782), Expect = 8e-88 Identities = 153/326 (46%), Positives = 217/326 (66%), Gaps = 3/326 (0%) Query: 3 KFTKALAAIGLAAVMSQ-SAMAENLKLGFLVKQPEEPWFQTEWKFADKAGKDLGFEVIKI 61 +F KA+A G A+ + SA A ++K+GF+VKQPEEPWFQ EWKFAD+A K+ GF ++KI Sbjct: 2 RFIKAVALAGTVAIFAATSAFAADVKIGFIVKQPEEPWFQDEWKFADEAAKEKGFTLVKI 61 Query: 62 AVPDGEKTLNAIDSLAASGAKGFVICTPDPKLGSAIVAKARGYDMKVIAVDDQFVNAKGK 121 DGEK +AID+L A GA+GF+ICTPD KLG IVAKA D+K++ VDD+ VNA G Sbjct: 62 GAQDGEKVQSAIDNLGAQGAQGFIICTPDVKLGPGIVAKAAANDLKLMTVDDRLVNADGS 121 Query: 122 PMDTVPLVMMAATKIGERQGQELYKEMQKRGWDVKESAVMAITANELDTARRRTTGSMDA 181 P++ VP + ++ATKIGE G+ + E++KRGWD+KE + ++ ++L TA R G++ Sbjct: 122 PIEDVPHMGISATKIGEAVGEAIVAEIKKRGWDMKEVGAIRVSYDQLPTAVDRVEGALSV 181 Query: 182 LKAAGFPEKQIYQVPTKSNDIPGAFDAANSMLVQHPEVKHWLIVGMNDSTVLGGVRATEG 241 LKA GFPE ++ P D A +AA +L ++ +K W+ VG+ND VLG VRATE Sbjct: 182 LKANGFPEANVFDAPQAKTDTEAALNAATVVLNKNAGIKKWVAVGLNDEAVLGAVRATET 241 Query: 242 QGFKAADIIGIGINGVD-AVSELSKAQATGFYGSLLPSPDVHGYKSSEMLYNWVAKDVEP 300 G A +IGIGI G D A++E K ATGF+G+++ SP HGY+++ +Y W+A EP Sbjct: 242 VGIPADSMIGIGIGGADSAINEFKKPSATGFFGTVIISPKRHGYETALNMYEWIANGKEP 301 Query: 301 PKFTEVTDVVLITRDNFKEELEKKGL 326 K +T L RDN++ ++ G+ Sbjct: 302 EKLI-LTAGQLALRDNYEAVRKELGI 326 Lambda K H 0.315 0.132 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 332 Number of extensions: 12 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 329 Length of database: 327 Length adjustment: 28 Effective length of query: 301 Effective length of database: 299 Effective search space: 89999 Effective search space used: 89999 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory