Align Periplasmic binding protein/LacI transcriptional regulator (characterized, see rationale)
to candidate SM_b21587 SM_b21587 sugar uptake ABC transporter substrate-binding protein precursor
Query= uniprot:A0KWY4 (313 letters) >FitnessBrowser__Smeli:SM_b21587 Length = 320 Score = 352 bits (903), Expect = e-102 Identities = 179/316 (56%), Positives = 235/316 (74%), Gaps = 10/316 (3%) Query: 5 KIITALGLWAVSATCAYATT------VGFSQVGSESGWRTSFSEAVKAEAKQRGIDLKFA 58 KI+ AL + A C + + VGFSQ+GSESGWR + + K +A++RGIDLKFA Sbjct: 2 KIVKALASATILAACTFGSASAAELVVGFSQIGSESGWRAAETTLTKQQAEERGIDLKFA 61 Query: 59 DAQQKQENQIKAVRSFIAQGVDAIIIAPVVETGWKPVLKEAKRAKIPVVIVDRNIKVDDD 118 DAQQKQENQIKA+RSFIAQGV+AI++APVV TGW VL+EAK A+IPV+++DR + DD Sbjct: 62 DAQQKQENQIKAIRSFIAQGVNAILLAPVVATGWDEVLEEAKDAEIPVILLDRTVDASDD 121 Query: 119 SLFLTRIASDFSEEGRKIGQWLMDKTQGN-CDIAELQGTVGATAAIDRAAGFNQVIANYP 177 L+LT + SD EG G+WL+D G C++ ELQGT G++ AIDR GF Q ++ Sbjct: 122 -LYLTAVTSDLVHEGSVAGKWLVDTVAGKPCNVVELQGTTGSSPAIDRKKGFEQALSGND 180 Query: 178 NAKIVRSQTGEFTRAKGKEVMEGFLKAQN-GQPLCAVWSHNDEMALGAVQAIKEAGLKPG 236 N KIVRSQTG+FTR KGKEVME FLKA++ G+ +CA+++HND+MA+GA+QAIKEAGLKPG Sbjct: 181 NLKIVRSQTGDFTRTKGKEVMESFLKAEDGGKNICALYAHNDDMAVGAIQAIKEAGLKPG 240 Query: 237 KDILIVSVDGVPDYFKAMADGDVNATVELSPYLGGPAFDAIDAYLKGNKDQAKLISTTGD 296 KDIL+VS+D VPD F+AMA G+ NATVEL+P + GPAFDA+ A+LK K+ K I T Sbjct: 241 KDILVVSIDAVPDIFQAMAAGEANATVELTPNMAGPAFDALAAFLKDGKEPPKWIQTESK 300 Query: 297 VFTQ-ETAAAEYEKRR 311 ++TQ + YE+++ Sbjct: 301 LYTQADDPMKVYEEKK 316 Lambda K H 0.316 0.131 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 337 Number of extensions: 12 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 313 Length of database: 320 Length adjustment: 27 Effective length of query: 286 Effective length of database: 293 Effective search space: 83798 Effective search space used: 83798 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory