Align Inner-membrane translocator (characterized, see rationale)
to candidate SM_b20352 SM_b20352 sugar ABC transporter permease
Query= uniprot:A0KWY6 (405 letters) >FitnessBrowser__Smeli:SM_b20352 Length = 354 Score = 170 bits (430), Expect = 7e-47 Identities = 105/315 (33%), Positives = 178/315 (56%), Gaps = 21/315 (6%) Query: 77 LFIDSSFFNISYQDDRLYGSLIDILNRSAPVALLSIGMSLVIATGGIDLSVGAVMAIAGA 136 LF +FF+I + +LI + A A L++GM+ VI TGGIDLSVG+++ + G Sbjct: 31 LFAVVAFFSIFAPNFLSTANLILMSKHVALNAFLAMGMTFVIITGGIDLSVGSIVGLCGM 90 Query: 137 VCANLLL---------VPDISLVTVIAAGLIVGLLAGCINGGLVSFLGIQPIVATLLLMV 187 V L+L ++V V L VG++ G +NG L++ L + P +ATL + Sbjct: 91 VAGGLILNGIDLQFGYTVYFNVVEVCLITLAVGIVIGAVNGLLITKLNVAPFIATLGTLY 150 Query: 188 AGRGVAQLINQGQIITFQH---------PGFAAIGVGQFLGLPMPVWIVIGMLTFSQLLL 238 RG A L + GQ TF + GFA +G G+ LGLP+ +W++I + + + Sbjct: 151 VARGFALLSSGGQ--TFPNLVGKPELATTGFAFLGSGRLLGLPVSIWVLIVVALAAAYVA 208 Query: 239 RKTALGLFIEAVGCNAKASRYLGINDKSIKLFAYGIAGLCAALAGMISTADIQGSDANNA 298 R T +G I AVG N +A+R GI +K+F Y +G CAA+ G++ ++++ S Sbjct: 209 RYTPIGRHIFAVGGNERAARMSGIRVDRVKMFVYMFSGFCAAIVGLVISSELMASHP-AT 267 Query: 299 GLWLELDAVLAVVIGGAALTGGRFSLILSVVGALIIQTLATTIIVSGLPAKFNLLIKAIV 358 G EL+A+ A V+GG +++GGR ++ +++GA +I L+ +++ G+ + + ++IK IV Sbjct: 268 GNSFELNAIAAAVLGGTSMSGGRGTIGGTIIGAFVIGILSDGLVMMGISSFWQMVIKGIV 327 Query: 359 ILTVLLLQSAKFRRQ 373 I+ +++ A+ R Q Sbjct: 328 IIVAVVVDQAQRRLQ 342 Lambda K H 0.323 0.136 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 316 Number of extensions: 14 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 354 Length adjustment: 30 Effective length of query: 375 Effective length of database: 324 Effective search space: 121500 Effective search space used: 121500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory