Align Xylose/arabinose import ATP-binding protein XacJ; EC 7.5.2.13 (characterized, see rationale)
to candidate SMc02474 SMc02474 ABC transporter ATP-binding protein
Query= uniprot:D4GP38 (383 letters) >FitnessBrowser__Smeli:SMc02474 Length = 356 Score = 283 bits (725), Expect = 4e-81 Identities = 162/372 (43%), Positives = 224/372 (60%), Gaps = 21/372 (5%) Query: 1 MGQIQLTDLTKRFGDTVAVDDLSLDIDDEEFLVLVGPSGCGKSTTLRMLAGLETPTSGDI 60 M ++L D+ K + V +SL I + EF+ LVGPSGCGKST LRM+AGLE + G++ Sbjct: 1 MASVELRDIRKSYAALEVVHGVSLSIAEGEFIALVGPSGCGKSTLLRMIAGLEEISDGEV 60 Query: 61 YIGGDHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEEEEGYTSAERDERVVEVAE 120 IGG +N P+ R+IAMVFQ YALYPHM+V +N+ F L+ G + E D++V E A Sbjct: 61 LIGGKVVNPLTPRERNIAMVFQSYALYPHMSVAENMGFNLKLS-GLSRPEIDKKVGEAAR 119 Query: 121 TLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDEPLSNLDAKLRAEMRTELQNL 180 L + +LLDRKP +LSGGQ+QR A+GRAIVRDP VFL DEPLSNLDAKLR +MRTE++ L Sbjct: 120 MLALTELLDRKPSQLSGGQRQRAAMGRAIVRDPAVFLFDEPLSNLDAKLRVQMRTEIKAL 179 Query: 181 QDQLAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVASPFECYHEPNNLFVAEFIGEPMI 240 ++A T++YVTH+Q EAMT+ADRI V++ G ++QV +P E Y P NLFVA FIG P + Sbjct: 180 HQKVATTSIYVTHDQIEAMTLADRIVVLNGGRIEQVGTPLELYRTPANLFVAGFIGSPAM 239 Query: 241 NLVRGTRSESTFVGEHFSYPLDEDVMESVDDR-----DDFVLGVRPEDIEVADAAPDDAA 295 N++ GT GE D + +R +G+RPE A Sbjct: 240 NVLDGTVDADD--GEPAVRLGDGSAIRIAPERKVRPGQAVRIGLRPEHFV--------AG 289 Query: 296 LDDHDLQMDVTVVEPHGDQNVLHLSHPDQPSADDALQAVTEGMHLVTRGDRVTVTIPPDK 355 + + + +VEP G Q +H A + + AV +G H G + + Sbjct: 290 GEGNAIAGQTLLVEPTGAQ-----THVLFEFAGEQITAVVDGDHPARHGSLFRAAMDRSQ 344 Query: 356 IHLFDAETGTAV 367 +++FD +TG A+ Sbjct: 345 VYVFDRQTGAAL 356 Lambda K H 0.317 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 355 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 356 Length adjustment: 30 Effective length of query: 353 Effective length of database: 326 Effective search space: 115078 Effective search space used: 115078 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory