Align Xylose/arabinose import ATP-binding protein XylG; EC 7.5.2.13 (characterized, see rationale)
to candidate SMc03815 SMc03815 ABC transporter ATP-binding protein
Query= uniprot:P0DTT6 (251 letters) >FitnessBrowser__Smeli:SMc03815 Length = 259 Score = 201 bits (512), Expect = 9e-57 Identities = 105/242 (43%), Positives = 162/242 (66%), Gaps = 5/242 (2%) Query: 1 MSDLLEIRDVHKSFGAVKALDGVSMEINKGEVVALLGDNGAGKSTLIKIISGYHKPDRGD 60 M+ L + ++ K FGAV+ALDGV++EIN+GE++ L+GDNGAGKSTL+K I+G +P G Sbjct: 13 MTVLARLENIVKDFGAVRALDGVTLEINQGEILGLMGDNGAGKSTLVKTIAGNFQPSSGS 72 Query: 61 LVFEGKKVIFNSPNDARSLGIETIYQDLALIPDLPIYYNIFLAREVTNKI----FLNKKK 116 + EGK V+F+ P +AR GIE +YQDLA+ +L N+FL RE+ ++ L+ K+ Sbjct: 73 YILEGKPVVFSGPAEARRHGIEVVYQDLAICDNLTASANVFLGRELMRQVGPFKVLDHKR 132 Query: 117 MMEESKKLLDSLQIRIPDINMKVENLSGGQRQAVAVARAVYFSAKMILMDEPTAALSVVE 176 M S ++ L+ ++ V +SGGQRQAVA+AR +K++LMDEPTAA+SV + Sbjct: 133 MNARSAEIFKELKSETRPADL-VVRMSGGQRQAVAIARTRLARSKIVLMDEPTAAISVRQ 191 Query: 177 ARKVLELARNLKKKGLGVLIITHNIIQGYEVADRIYVLDRGKIIFHKKKEETNVEEITEV 236 +VL L R +K +GL V++I+H + +EV DR+ V+ RG+ + K +++ EE+T + Sbjct: 192 VAEVLALIRRMKAQGLSVILISHRMPDVFEVCDRVVVMRRGRKVADKMIGQSSPEEVTGL 251 Query: 237 MT 238 +T Sbjct: 252 IT 253 Lambda K H 0.318 0.137 0.371 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 149 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 251 Length of database: 259 Length adjustment: 24 Effective length of query: 227 Effective length of database: 235 Effective search space: 53345 Effective search space used: 53345 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory