Align N-carbamoylputrescine amidase; EC 3.5.1.53 (characterized)
to candidate SMc01962 SMc01962 hypothetical protein
Query= SwissProt::Q9XGI9 (300 letters) >FitnessBrowser__Smeli:SMc01962 Length = 259 Score = 100 bits (248), Expect = 5e-26 Identities = 81/262 (30%), Positives = 128/262 (48%), Gaps = 26/262 (9%) Query: 7 LVTVAALQF-ACTDDVSTNVATAERLVRAAHQKGANIILIQEL-FEGYYFCQAQKEEFFH 64 ++ AALQ + DV+ N+A ER A +GA++++ EL GY E Sbjct: 1 MMKFAALQMKSIGGDVAANLARIERAAIGASGEGASLLVAPELAITGY----GAGEAIRR 56 Query: 65 RAKPYPGHPTIVR-MQNLAKELGVVIPVSFFEEANNAHYNSVAIIDADGTDLGLYRKSHI 123 A+P G IVR + ++ + G+ I F E+ +A YNS +D D + +YRKSH+ Sbjct: 57 LAEPADGR--IVRELGRISLKTGIAIVAGFAEQGADAVYNSAVHVDGDAVPV-VYRKSHL 113 Query: 124 PDGPGYQEKYYFNPGDTGFKVFQTKYAKIGVAICWDQWFPEAARAMALQGAEVLFYPTAI 183 G E+ F P + ++F+ + G+ IC+D FPE R +AL GA+ + PTA+ Sbjct: 114 Y---GDYERSLFTPAEPSTRLFKHRGVTCGMLICYDVEFPENVRRLALAGADAVLVPTAL 170 Query: 184 GSEPQDDGLDSRDHWRRVMQGHAGANVVPLVASNRIGKEIIETEHGNSEITFYGYSFIAG 243 + G DH ++Q A N V + N G + +F G S IA Sbjct: 171 PA--GWSGTFITDH---MIQTRAFENQVFVAYVNHCGSD--------DMFSFAGLSLIAS 217 Query: 244 PTGELVAAAGDKEEAVLVAQFD 265 P G+ +A AG +E +++A+ D Sbjct: 218 PDGQALAKAGSSDETLIIAEID 239 Lambda K H 0.319 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 194 Number of extensions: 12 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 259 Length adjustment: 26 Effective length of query: 274 Effective length of database: 233 Effective search space: 63842 Effective search space used: 63842 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory